Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5T5S1 B2RP89 C9JD38 Q6P2D9 Q8NAI4 Q8TF18
Symbols PARF
KIAA1984
bA216L13.7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MRRHSETDVEEQTQELKTITQLQEQCRALQIQGVKENMDQNKATLALLRSNIRRGAQDWALAKKYDQWTI      1 - 70
SKACGKNLPLRLAHCRSTMEVVREKLRKYVFDRVNMHNLLIHLVRRRGQKLESMQLELDSLRSQPDASKE     71 - 140
ELRLLQIIRQLENNIEKTMIKIITSQNIHLLYLDLLDYLKTVLAGYPIELDKLQNLVVNYCSELSDMKIM    141 - 210
SQDAMMITDEVKRNMRQREASFIEERRARENRLNQQKKLIDKIHTKETSEKYRRGQMDLDFPSNLMSTET    211 - 280
LKLRRKETSTAEMEYQSGVTAVVEKVKSAVRCSHVWDITSRFLAQRNTEENLELQMEDCEEWRVQLKALV    281 - 350
KQLELEEAVLKFRQKPSSISFKSVEKKMTDMLKEEEERLQLAHSNMTKGQELLLTIQMGIDNLYVRLMGI    351 - 420
NLPATQREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENR    421 - 490
EEDMIDTFQFPDMDHSYVPSRAEIKRQAQRLIEGKLKAAKKKKK                              491 - 534
//

Text Mined References (7)

PMID Year Title