Property Summary

NCBI Gene PubMed Count 13
PubMed Score 156.46
PubTator Score 7.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.567 5.7e-06
adrenocortical carcinoma -1.547 2.0e-03
adult high grade glioma -2.300 1.1e-03
aldosterone-producing adenoma -1.057 3.2e-03
astrocytic glioma -3.000 1.2e-03
Atopic dermatitis 1.200 9.6e-05
atypical teratoid / rhabdoid tumor 1.300 1.9e-03
Breast cancer -1.600 2.7e-21
cystic fibrosis 2.023 9.9e-06
ependymoma -3.100 3.1e-03
glioblastoma -1.800 1.0e-04
group 3 medulloblastoma -2.300 9.3e-03
interstitial cystitis -1.100 6.4e-03
intraductal papillary-mucinous adenoma (... 1.100 1.4e-03
intraductal papillary-mucinous carcinoma... 1.100 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.0e-02
invasive ductal carcinoma 1.200 2.2e-02
lung carcinoma -1.200 1.1e-06
medulloblastoma, large-cell 1.200 1.3e-04
non-small cell lung cancer 1.107 2.3e-15
oligodendroglioma -2.300 6.3e-03
osteosarcoma 2.120 1.4e-06
ovarian cancer 1.600 1.6e-07
pancreatic cancer 1.500 1.1e-02
pituitary cancer -1.600 1.7e-05
primary pancreatic ductal adenocarcinoma 1.472 7.2e-03
primitive neuroectodermal tumor -2.500 4.3e-03

Gene RIF (7)

AA Sequence

MEENESQKCEPCLPYSADRRQMQEQGKGNLHVTSPEDAECRRTKERLSNGNSRGSVSKSSRNIPRRHTLG      1 - 70
GPRSSKEILGMQTSEMDRKREAFLEHLKQKYPHHASAIMGHQERLRDQTRSPKLSHSPQPPSLGDPVEHL     71 - 140
SETSADSLEAMSEGDAPTPFSRGSRTRASLPVVRSTNQTKERSLGVLYLQYGDETKQLRMPNEITSADTI    141 - 210
RALFVSAFPQQLTMKMLESPSVAIYIKDESRNVYYELNDVRNIQDRSLLKVYNKDPAHAFNHTPKTMNGD    211 - 280
MRMQRELVYARGDGPGAPRPGSTAHPPHAIPNSPPSTPVPHSMPPSPSRIPYGGTRSMVVPGNATIPRDR    281 - 350
ISSLPVSRPISPSPSAILERRDVKPDEDMSGKNIAMYRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDH    351 - 420
IIAYHRTAIRSASAYCNPSMQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVSDLRMIDMHAHY    421 - 490
NAHGPPHTMQPDRASPSRQAFKKEPGTLVYIEKPRSAAGLSSLVDLGPPLMEKQVFAYSTATIPKDRETR    491 - 560
ERMQAMEKQIASLTGLVQSALFKGPITSYSKDASSEKMMKTTANRNHTDSAGTPHVSGGKMLSALESTVP    561 - 630
PSQPPPVGTSAIHMSLLEMRRSVAELRLQLQQMRQLQLQNQELLRAMMKKAELEISGKVMETMKRLEDPV    631 - 700
QRQRVLVEQERQKYLHEEEKIVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKG    701 - 770
EFPTLQNKMRAILRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDAAQAAQYMAM    771 - 840
EKATAAEVLKSQEEAAHTSGQPFHSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQHSVALLNPAQNL    841 - 910
PHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKNRAVSIEKAEKKWEEKRQNLD    911 - 980
HYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAPVDKVELSEDSPNSEQDLEKLGGKSPPPPPP    981 - 1050
PPRRSYLPGSGLTTTRSGDVVYTGRKENITAKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSS   1051 - 1120
KDEEEEEEEGDKIMAELQAFQKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKS   1121 - 1190
DVEYENGPQMEFQKVTTGAVRPSDPPKWERGMENSISDASRTSEYKTEIIMKENSISNMSLLRDSRNYSQ   1191 - 1260
ETVPKASFGFSGISPLEDEINKGSKISGLQYSIPDTENQTLNYGKTKEMEKQNTDKCHVSSHTRLTESSV   1261 - 1330
HDFKTEDQEVITTDFGQVVLRPKEARHANVNPNEDGESSSSSPTEENAATDNIAFMITETTVQVLSSGEV   1331 - 1400
HDIVSQKGEDIQTVNIDARKEMTPRQEGTDNEDPVVCLDKKPVIIIFDEPMDIRSAYKRLSTIFEECDEE   1401 - 1470
LERMMMEEKIEEEEEEENGDSVVQNNNTSQMSHKKVAPGNLRTGQQVETKSQPHSLATETRNPGGQEMNR   1471 - 1540
TELNKFSHVDSPNSECKGEDATDDQFESPKKKFKFKFPKKQLAALTQAIRTGTKTGKKTLQVVVYEEEEE   1541 - 1610
DGTLKQHKEAKRFEIARSQPEDTPENTVRRQEQPSIESTSPISRTDEIRKNTYRTLDSLEQTIKQLENTI   1611 - 1680
SEMSPKALVDTSCSSNRDSVASSSHIAQEASPRPLLVPDEGPTALEPPTSIPSASRKGSSGAPQTSRMPV   1681 - 1750
PMSAKNRPGTLDKPGKQSKLQDPRQYRQANGSAKKSGGDFKPTSPSLPASKIPALSPSSGKSSSLPSSSG   1751 - 1820
DSSNLPNPPATKPSIASNPLSPQTGPPAHSASLIPSVSNGSLKFQSLTHTGKGHHLSFSPQSQNGRAPPP   1821 - 1890
LSFSSSPPSPASSVSLNQGAKGTRTIHTPSLTSYKAQNGSSSKATPSTAKETS                    1891 - 1943
//

Text Mined References (21)

PMID Year Title