Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 1.8e-09
nasopharyngeal carcinoma 1058 2.7e-07
chronic rhinosinusitis 512 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
pulmonary tuberculosis 9 3.77 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.498 3.9e-02
ependymoma 2.400 1.8e-09
nasopharyngeal carcinoma -1.300 2.7e-07

Gene RIF (1)

AA Sequence

MAEEREPELYLKWKHCETPGVKTLCNLKHCETPGVKTLCNLKKLLNRLQKDHREDVYLYISGHLNPNKLY      1 - 70
QPPETILQHWPNAHRPKGERASEVGEPPAGKVARMKEALAHFTIHTALVPSEAQDTPLFRYLNPQASLSH     71 - 140
TSEEDFLPVEAVREGKEEKKGGPPGRGPPGWRRREELRLPDLKVLCYQEAGSRGTRDRHHYVSSYLAGAT    141 - 210
SADRYRMFLRFQKEVLAKQDLLKNDFTGSKAAAGHERKLQQELQKICTCSPQQFNRLHVFGKVFEDICNS    211 - 280
SLIFGDLLKKVKDEYELYMATLLESQPAAQYEALLAQLKALGQRPVKTADMDLAREELRMLVTATKAALE    281 - 350
QNDRLRSELEMEVALLQSAKERSESSEKHIIDENRLTLTEKVEKKRCEILSKWDEIQALEKEIKTTLVHT    351 - 420
GISDITENRIKSIEHEAIQLETENMILKKKIKGPLEIYQGICKIRGNRR                         421 - 469
//

Text Mined References (7)

PMID Year Title