Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.99
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.21379650074285E-7
medulloblastoma, large-cell 6234 4.15332375286787E-7
primitive neuroectodermal tumor 3031 4.6593909201154E-6
group 3 medulloblastoma 2254 9.65764668933882E-6
atypical teratoid / rhabdoid tumor 4369 5.29157295934588E-5
tuberculosis and treatment for 6 months 686 1.28528212629245E-4
lung cancer 4473 4.75437045635288E-4

Expression

  Differential Expression (7)

Synonym

Accession Q5T5M9 B7Z4E7 Q86XL1 Q9NV69
Symbols bA690P14.1

Gene

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (3)

PMID Text
26469956 CCNJ is a target of miR205 mediated downregulation in bladder cancer cells.
25672416 In conclusion, our results indicated that CCNJ could be a novel prognostic marker of HCC, and this study indicated that triple combination array analysis was effective in detecting new tumor-related genes and their mechanisms.
24098452 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-alpha, CCNJ, and MEGF9.

AA Sequence

MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDL      1 - 70
FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQW     71 - 140
NLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSP    141 - 210
TWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYL    211 - 280
HQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLS    281 - 350
VSYNRSYQINEHYPCITPCFER                                                    351 - 372
//

Text Mined References (9)

PMID Year Title
26469956 2015 Long non-coding RNA HOTAIR regulates cyclin J via inhibition of microRNA-205 expression in bladder cancer.
25672416 2015 CCNJ detected by triple combination array analysis as a tumor-related gene of hepatocellular carcinoma.
24098452 2013 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-?, CCNJ, and MEGF9.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.