Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.02
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.4e-05
group 3 medulloblastoma 2.300 9.7e-06
lung cancer 1.100 4.8e-04
medulloblastoma, large-cell 1.900 1.7e-05
osteosarcoma -2.823 3.2e-07
primitive neuroectodermal tumor 2.000 2.2e-05
tuberculosis and treatment for 6 months 1.100 1.3e-04

Synonym

Accession Q5T5M9 B7Z4E7 Q86XL1 Q9NV69
Symbols bA690P14.1

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (5)

AA Sequence

MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDL      1 - 70
FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQW     71 - 140
NLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSP    141 - 210
TWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYL    211 - 280
HQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLS    281 - 350
VSYNRSYQINEHYPCITPCFER                                                    351 - 372
//

Text Mined References (11)

PMID Year Title