Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.25
PubTator Score 4.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.0e-04
group 3 medulloblastoma 4104 4.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Kidney sarcoma 2 4.677 2.3
Rhabdoid cancer 5 3.78 1.9
Nephroblastoma 51 3.365 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 4.7e-04
osteosarcoma -1.561 2.0e-04

Synonym

Accession Q5T5J6 Q8NEK9 Q9BZQ7 Q9NXQ0
Symbols HsSwt1
C1orf26

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSSKESCGKKETSQRKDTTTSSPNFGEKDKKERKTPASSTSSSSIRSVSSEKRKLKSDHTDVLYYNIKRR      1 - 70
QGLKRLSVEIDTLRRRPKIGSSSQRPIKLKEASYSNDNQIILQSPSSNGTKKDIHKCVDFKPKDIKLTNA     71 - 140
GSKLDHGIKSLSSPKIASDVKPKAEGQASENKWSHLLVQREKMKELKKGRNSKFRDNSEKCVLEKWKRNQ    141 - 210
FSQDYNSNKIIKEPLGSRRQKISFKIPIKSRDTLQKLVEENVFNIDSNNSKTKQEEREYLESSQVSLNVT    211 - 280
RQKTEHLLSDFTYKRTVHEWKRKHHYDHQESNDSHSRENLTQSFEAPCCSVSSESIQDADQEMQIVEELH    281 - 350
AARVGKSVDLPGELMSMEIDLEDDVHSSSANNTSDRKLLIVIDTNILMNHLKFVRILKTTEVPGFDKLVL    351 - 420
IIPWVVMQELDRMKEGKLLKRAQHKAIPAVHFINDSLKNQDRKLWGQSIQLASQKHYGLSDENNDDRVLK    421 - 490
CCLQHQELFPCSFVILCTDDRNLRNKGLISGVKSLSKEELSAELLHLSLNTDVCHQPCIPKQQLKAETTP    491 - 560
LKESYKEESTNSGLSILLESIVSDLEKSLGTGLSSILETEMKIAFGNLWMEILYLKPPWTLLHLLQCFKK    561 - 630
HWLAVFGLVMEKNLLLTIESLYKNLRKANKAVDFTTVKFLLQDSRSLLHAFSTRSNYDGILPQTFAQVNN    631 - 700
LLQTFAEVKTKLKPNSSENTVTKKQEGTSLKNSHNQEITVFSSSHLPQPSRHQEIWSILESVWITIYQNS    701 - 770
TDVFQRLGSNSALTTSNIASFEEAFICLQKLMAAVRDILEGIQRILAPNSNYQDVETLYNFLIKYEVNKN    771 - 840
VKFTAQEIYDCVSQTEYREKLTIGCRQLVEMEYTMQQCNASVYMEAKNRGWCEDMLNYRI              841 - 900
//

Text Mined References (11)

PMID Year Title