Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 8.5e-09

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.200 8.5e-09

Synonym

Accession Q5T5F5 Q6ZS69
Symbols C1orf138

 Compartment GO Term (0)

AA Sequence

MWLWQDIQCCPAPPSAPPRALEPGRAPPPPGEGLGAGIPSLSPPQKKPQSVGICVRQKGRQKAGLEKGNR      1 - 70
KKELRQANCPSLRPQRKGADTRRLPRETRPTKKRTAAAQPFLQLWNPAPHTSNGRTGDL                71 - 129
//

Text Mined References (4)

PMID Year Title