Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung carcinoma 2,844

Expression

Synonym

Accession Q5T5F5 Q6ZS69
Symbols C1orf138

 Compartment GO Term (0)

AA Sequence

MWLWQDIQCCPAPPSAPPRALEPGRAPPPPGEGLGAGIPSLSPPQKKPQSVGICVRQKGRQKAGLEKGNR      1 - 70
KKELRQANCPSLRPQRKGADTRRLPRETRPTKKRTAAAQPFLQLWNPAPHTSNGRTGDL                71 - 129
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.