Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 7.10633755879084E-6
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0128730274553185

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.369 0.000
pancreatic ductal adenocarcinoma liver m... -1.123 0.013

Synonym

Accession Q5T5D7 Q2NKY4
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG

AA Sequence

MISFQESVTFQDVAVDFTAEEWQLLDCAERTLYWDVMLENYRNLISVGCPITKTKVILKVEQGQEPWMVE      1 - 70
GANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNMSTSLNPMRKKSYKSFEKCL     71 - 140
PPNLDLLKYNRSYTVENAYECSECGKAFKKKFHFIRHEKNHTRKKPFECNDCGKAYSRKAHLATHQKIHN    141 - 210
GERPFVCNDCGKAFMHKAQLVVHQRLHTGEKPYECSQCGKTFTWNSSFNQHVKSHTLEKSFECKECGKTF    211 - 280
RYSSSLYKHSRFHTGEKPYQCIICGKAFGNTSVLVTHQRIHTGEKPYSCIECGKAFIKKSHLLRHQITHT    281 - 350
GEKPYECNRCGKAFSQKSNLIVHQKIHT                                              351 - 378
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.