Property Summary

NCBI Gene PubMed Count 26
PubMed Score 45.30
PubTator Score 23.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 1.2e-03
aldosterone-producing adenoma -1.031 2.8e-02
astrocytic glioma -1.300 2.5e-02
Astrocytoma, Pilocytic -1.400 1.2e-05
atypical teratoid / rhabdoid tumor -1.700 7.6e-05
ependymoma -2.700 3.0e-03
glioblastoma -1.400 6.3e-06
group 3 medulloblastoma -1.700 3.3e-02
lung carcinoma 1.100 9.1e-22
medulloblastoma, large-cell -1.500 2.1e-04
oligodendroglioma -2.100 2.8e-02
osteosarcoma -1.969 3.8e-05
ovarian cancer 1.200 9.2e-03
Pick disease -1.400 3.0e-02
primitive neuroectodermal tumor -1.400 1.4e-03
sarcoidosis 1.200 3.6e-03
spina bifida -1.775 4.1e-02

Gene RIF (13)

AA Sequence

MRKFNIRKVLDGLTAGSSSASQQQQQQHPPGNREPEIQETLQSEHFQLCKTVRHGFPYQPSALAFDPVQK      1 - 70
ILAVGTQTGALRLFGRPGVECYCQHDSGAAVIQLQFLINEGALVSALADDTLHLWNLRQKRPAILHSLKF     71 - 140
CRERVTFCHLPFQSKWLYVGTERGNIHIVNVESFTLSGYVIMWNKAIELSSKSHPGPVVHISDNPMDEGK    141 - 210
LLIGFESGTVVLWDLKSKKADYRYTYDEAIHSVAWHHEGKQFICSHSDGTLTIWNVRSPAKPVQTITPHG    211 - 280
KQLKDGKKPEPCKPILKVEFKTTRSGEPFIILSGGLSYDTVGRRPCLTVMHGKSTAVLEMDYSIVDFLTL    281 - 350
CETPYPNDFQEPYAVVVLLEKDLVLIDLAQNGYPIFENPYPLSIHESPVTCCEYFADCPVDLIPALYSVG    351 - 420
ARQKRQGYSKKEWPINGGNWGLGAQSYPEIIITGHADGSVKFWDASAITLQVLYKLKTSKVFEKSRNKDD    421 - 490
RPNTDIVDEDPYAIQIISWCPESRMLCIAGVSAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGE    491 - 560
QPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPCLKVKNSPLKQSPGYQTELVIQLVWVGGEPPQ    561 - 630
QITSLAVNSSYGLVVFGNCNGIAMVDYLQKAVLLNLGTIELYGSNDPYRREPRSPRKSRQPSGAGLCDIS    631 - 700
EGTVVPEDRCKSPTSGSSSPHNSDDEQKMNNFIEKVKTKSRKFSKMVANDIAKMSRKLSLPTDLKPDLDV    701 - 770
KDNSFSRSRSSSVTSIDKESREAISALHFCETFTRKTDSSPSPCLWVGTTLGTVLVIALNLPPGGEQRLL    771 - 840
QPVIVSPSGTILRLKGAILRMAFLDTTGCLIPPAYEPWREHNVPEEKDEKEKLKKRRPVSVSPSSSQEIS    841 - 910
ENQYAVICSEKQAKVISLPTQNCAYKQNITETSFVLRGDIVALSNSICLACFCANGHIMTFSLPSLRPLL    911 - 980
DVYYLPLTNMRIARTFCFTNNGQALYLVSPTEIQRLTYSQETCENLQEMLGELFTPVETPEAPNRGFFKG    981 - 1050
LFGGGAQSLDREELFGESSSGKASRSLAQHIPGPGGIEGVKGAASGVVGELARARLALDERGQKLGDLEE   1051 - 1120
RTAAMLSSAESFSKHAHEIMLKYKDKKWYQF                                          1121 - 1151
//

Text Mined References (32)

PMID Year Title