Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.1e-235
diabetes mellitus 1728 1.3e-03

Gene RIF (1)

AA Sequence

MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNS      1 - 70
CDRGSGQQGGGSGCCHGSGGCC                                                     71 - 92
//

Text Mined References (8)

PMID Year Title