Property Summary

NCBI Gene PubMed Count 26
PubMed Score 16.16
PubTator Score 19.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
psoriasis 6694 5.354 5.07777276396518E-40
Asthma 385 0.0 0.9
Disease Target Count Z-score Confidence
Psoriatic arthritis 86 3.937 2.0

Gene RIF (28)

AA Sequence

MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRS      1 - 70
NSCDRGSGQQGGGSCRGHGSGGCC                                                   71 - 94
//

Text Mined References (27)

PMID Year Title