Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 3.900 0.000
lung adenocarcinoma -1.100 0.000
nasopharyngeal carcinoma -1.600 0.000
non-small cell lung carcinoma -1.200 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q5T5A4 Q5T5A3
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

AA Sequence

MPPTRDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKD      1 - 70
DLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIH     71 - 140
SIQGSIVSPHTAATNGGYSRKKDGGFFST                                             141 - 169
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.