Property Summary

NCBI Gene PubMed Count 33
Grant Count 86
R01 Count 51
Funding $8,666,392.36
PubMed Score 182.62
PubTator Score 152.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.838 0.000
cystic fibrosis 1.100 0.000

Synonym

Accession Q5T4W7 D3DPY1 D3DPY3 O95441 O96030 Q6P6A3
Symbols ART
EVN
NBN
ENOVIN

Gene

PDB

2ASK   2GH0   2GYR   2GYZ  

Gene RIF (25)

PMID Text
26270588 mRNA expression of Artemin (Artn) in the tongue mucosa of patients with burning mouth syndrome was significantly higher than that of control subjects.
25243385 Artemin expression promotes invasiveness and neurotrophic function of pancreatic adenocarcinoma cells in vivo and in vitro
24994477 This is the first report of increased levels of a neurotrophic factor and of a glial cell line-derived neurotrophic factor family member in GAD patients.
24737320 conclude that ARTN is one mediator of acquired resistance to trastuzumab in HER2-positive mammary carcinoma cells
23351331 The expression of GFRalpha1 and/or GFRalpha3, especially when combined with ARTN expression, may be useful predictors of disease progression and outcome in specific subtypes of mammary carcinoma.
23185544 ARTEMIN promotes de novo angiogenesis in ER negative mammary carcinoma through activation of TWIST1-VEGF-A signaling.
23095743 ARTN promotion of the cancer stem cell-like cell phenotype was mediated by TWIST1 regulation of BCL-2 expression.
22901124 High artemin promotes motility and invasiveness of pancreatic cancer.
22770266 artemin lowers the threshold of temperature-dependent itch sensation.
22060274 ARTN and TWIST1 synergize to produce a worse outcome in ER-MC and combined inhibition of ARTN and phosphatidylinositol 3-kinase/protein kinase B (PI3K/AKT) may therefore provide a novel therapeutic strategy in this subtype of mammary carcinoma.
More...

AA Sequence

MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRT      1 - 70
ARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHR     71 - 140
SDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDR    141 - 210
LSATACGCLG                                                                211 - 220
//

Text Mined References (33)

PMID Year Title
26908049 2016 Investigating the Role of Artemin Glycosylation.
26675549 2016 Artemin is hypoxia responsive and promotes oncogenicity and increased tumor initiating capacity in hepatocellular carcinoma.
26270588 2015 Involvement of peripheral artemin signaling in tongue pain: possible mechanism in burning mouth syndrome.
25243385 2015 Neurotrophic Factor Artemin Promotes Invasiveness and Neurotrophic Function of Pancreatic Adenocarcinoma In Vivo and In Vitro.
24994477 2014 BDNF and Artemin are increased in drug-naïve non-depressed GAD patients: preliminary data.
24737320 2014 Artemin, a member of the glial cell line-derived neurotrophic factor family of ligands, is HER2-regulated and mediates acquired trastuzumab resistance by promoting cancer stem cell-like behavior in mammary carcinoma cells.
23351331 2013 Prognostic significance of the expression of GFR?1, GFR?3 and syndecan-3, proteins binding ARTEMIN, in mammary carcinoma.
23185544 2012 ARTEMIN promotes de novo angiogenesis in ER negative mammary carcinoma through activation of TWIST1-VEGF-A signalling.
23095743 2012 Artemin stimulates radio- and chemo-resistance by promoting TWIST1-BCL-2-dependent cancer stem cell-like behavior in mammary carcinoma cells.
22901124 2012 Neurotrophic artemin promotes motility and invasiveness of MIA PaCa-2 pancreatic cancer cells.
More...