Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5T4J0
Symbols bA421M1.3

Gene

PANTHER Protein Class (2)

AA Sequence

MKVWSCYLCIITLQIIIIVTVLYNVHVSQPDSGQIDDVGGEYQALSRLHICDAALNGKTVQVLPSALSTM      1 - 70
FGIDSCPYYVLENHYITTPLSTEEAAFPLAYVMTISQDFDTFEWLFWAIYMPQNVYCIHVDKAATIDFKI     71 - 140
AVSELLECFSNAFISSQSEYIIYGGKSRLQADLACMRDLIASTVQWRYVTNTGDHDFPLKTNREIVQYLK    141 - 210
TMNWTNITPNLVSVLKSTERIKYTHREYRTRAHAFVLKKHKKKSPPPRQLKIHFGSSYVALTREFVHFAL    211 - 280
YNKIAIELLQRSQDTYSPDKHFWITLNNIPVEGTGPWILAVNSGSCQNRHICPRGLEFQQQYPVNSFGGN    281 - 350
NCSIAAGTAAPREALGPFHLKAACSAHQNKWGFWNCYLHLK                                 351 - 391
//

Text Mined References (2)

PMID Year Title
26344197 2015 Panorama of ancient metazoan macromolecular complexes.
14574404 2003 The DNA sequence and analysis of human chromosome 6.