Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 2.000 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q5T4I8 Q5T4I7 Q96AS6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAQPESSADFGIAQQNNYYCYWQSLPSAIRVKQEFQPSQSYRYGNWYARQHGSYLLSGYSYGCAVDGNGK      1 - 70
DCFSAHETPEHTAGTLVMPKETTPLAENQDEDPLEDPHLHLNIEESNQEFMVKSEELYDSLMNCHWQPLD     71 - 140
TVHSEIPDETPK                                                              141 - 152
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.