Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -2.900 7.6e-03
atypical teratoid / rhabdoid tumor 1.400 4.0e-03
ependymoma 1.200 8.7e-06
oligodendroglioma -2.200 3.3e-02
ovarian cancer 1.200 1.3e-02
pituitary cancer 2.400 1.3e-05

AA Sequence

MQSREPSGWRTAERRRGWRCRGVPTPSGDRGPGAARPAARGGAGETTGQQRPLQVPGASAAAARTRLLRW      1 - 70
HHRVPSPRATRSPGSIRRTSPCSGGPDRPERPECADACCYLLDPFTLPLIQDFFRGCAASDFDRRD         71 - 136
//

Text Mined References (5)

PMID Year Title