Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -2.900 0.008
oligodendroglioma -2.200 0.033
posterior fossa group A ependymoma 1.900 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
ovarian cancer 1.200 0.013
pituitary cancer 2.400 0.000

Synonym

Accession Q5T4H9 A1L4M3
Symbols C10orf114
bA418C1.3

Gene

 Compartment GO Term (1)

AA Sequence

MQSREPSGWRTAERRRGWRCRGVPTPSGDRGPGAARPAARGGAGETTGQQRPLQVPGASAAAARTRLLRW      1 - 70
HHRVPSPRATRSPGSIRRTSPCSGGPDRPERPECADACCYLLDPFTLPLIQDFFRGCAASDFDRRD         71 - 136
//

Text Mined References (5)

PMID Year Title
21804547 2011 Common variation at 10p12.31 near MLLT10 influences meningioma risk.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.