Property Summary

NCBI Gene PubMed Count 45
Grant Count 10
R01 Count 7
Funding $982,084.74
PubMed Score 67.90
PubTator Score 51.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
permanent atrial fibrillation -1.400 0.000
pancreatic cancer -1.300 0.001
psoriasis -2.100 0.000

Gene RIF (35)

PMID Text
26256895 Report reduced hepatic SFRP5 expression in morbidly women with NAFLD.
25382802 The wnt5a/sFRP5 system is altered in human sepsis and might therefore be of interest for future studies on molecular pathophysiology of this common human disease.
25324487 Sfrp5 represents a candidate for a mature adipocyte marker gene.
25139699 Data suggest that serum SFRP5 levels are up-regulated in subjects with newly diagnosed type 2 diabetes as compared to prediabetic or control subjects; subjects were matched for obesity/overweight/body mass index.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25089371 Serum WISP2 correlated directly with fatty acid binding protein 4. Serum SFRP5 did not differ between obese (n=32) vs. nonobese (n=25) PCOS women, but reference women had lower SFRP5 (p<5x10(-6) as compared to both PCOS groups).
24764263 Secreted frizzled-related protein 5 suppresses inflammatory response in rheumatoid arthritis fibroblast-like synoviocytes through down-regulation of c-Jun N-terminal kinase.
24603290 SFRP5 and WNT5A comprise a balanced duo that may regulate metabolic homeostasis in prepubertal children.
24530778 Serum SFRP5 levels significantly correlated with body mass index, the homeostasis model of assessment of insulin resistance, adiponectin levels, and CAD severity. Low SFRP5 levels may contribute to CAD.
24465779 Therefore, cytokine release and insulin signaling were analyzed to investigate the impact of Sfrp5 on inflammation and insulin signaling in primary human adipocytes and skeletal muscle cells (hSkMC).
More...

AA Sequence

MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKR      1 - 70
MRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAVRAGCAPLME     71 - 140
AYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKE    141 - 210
IKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMA    211 - 280
VYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH                                     281 - 317
//

Text Mined References (45)

PMID Year Title
26256895 SFRP5 hepatic expression is associated with non-alcoholic liver disease in morbidly obese women.
25382802 2015 The wingless-related integration site-5a/secreted frizzled-related protein-5 system is dysregulated in human sepsis.
25324487 2014 SFRP5 acts as a mature adipocyte marker but not as a regulator in adipogenesis.
25139699 2015 Circulating SFRP5 levels are elevated in drug-naïve recently diagnosed type 2 diabetic patients as compared with prediabetic subjects and controls.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25089371 2015 Roles of circulating WNT-signaling proteins and WNT-inhibitors in human adiposity, insulin resistance, insulin secretion, and inflammation.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24764263 2014 Secreted frizzled-related protein 5 suppresses inflammatory response in rheumatoid arthritis fibroblast-like synoviocytes through down-regulation of c-Jun N-terminal kinase.
24603290 2014 Balanced duo of anti-inflammatory SFRP5 and proinflammatory WNT5A in children.
24530778 2014 Low serum level of secreted frizzled-related protein 5, an anti-inflammatory adipokine, is associated with coronary artery disease.
More...