Property Summary

NCBI Gene PubMed Count 49
PubMed Score 74.93
PubTator Score 51.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
psoriasis 6694 7.5e-47
permanent atrial fibrillation 45 4.1e-06
pancreatic cancer 2398 7.1e-04
Disease Target Count Z-score Confidence
Obesity 678 3.459 1.7
Cancer 2499 3.372 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer -1.300 7.1e-04
permanent atrial fibrillation -1.400 4.1e-06
psoriasis -2.100 7.5e-47

Gene RIF (39)

AA Sequence

MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKR      1 - 70
MRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAVRAGCAPLME     71 - 140
AYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKE    141 - 210
IKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMA    211 - 280
VYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH                                     281 - 317
//

Text Mined References (49)

PMID Year Title