Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.85
PubTator Score 11.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.612 0.000
adult high grade glioma -1.100 0.000

Gene RIF (8)

PMID Text
23969831 SPG33 protein protrudin contains hydrophobic, intramembrane hairpin domains, interacts with tubular ER proteins, and functions in ER morphogenesis by regulating the sheet-to-tubule balance and possibly the density of tubule interconnections.
22573551 findings indicate that protrudin interacts with spastin and induces axon formation through its N-terminal domain. Moreover, protrudin and spastin may work together to play an indispensable role in motor axon outg
21976701 Protrudin-KIF5 complex contributes to the vesicular transport in neurons.
19289470 VAP-A is an important regulator both of the subcellular localization of protrudin and of its ability to stimulate neurite outgrowth.
18606302 The role of ZFYVE27/protrudin in hereditary spastic paraplegia is reported.
17082457 protrudin regulates Rab11-dependent membrane recycling to promote the directional membrane trafficking required for neurite formation [protrudin]
16826525 Mutation affects neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of hereditary spastic paraplegia.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP      1 - 70
LCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRL     71 - 140
SRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNS    141 - 210
TLFLGNVEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTEDLTPGSVEEAEE    211 - 280
AEPDEEFKDAIEETHLVVLEDDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNC    281 - 350
TGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK             351 - 411
//

Text Mined References (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24668814 2014 Protrudin regulates endoplasmic reticulum morphology and function associated with the pathogenesis of hereditary spastic paraplegia.
23969831 2013 Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation.
22573551 2012 Role of spastin and protrudin in neurite outgrowth.
21976701 2011 Protrudin serves as an adaptor molecule that connects KIF5 and its cargoes in vesicular transport during process formation.
19289470 2009 Promotion of neurite extension by protrudin requires its interaction with vesicle-associated membrane protein-associated protein.
18606302 2008 The role of ZFYVE27/protrudin in hereditary spastic paraplegia.
18459960 2008 Regulation of apoptosis and neurite extension by FKBP38 is required for neural tube formation in the mouse.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17082457 2006 Protrudin induces neurite formation by directional membrane trafficking.
More...