Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.34
PubTator Score 11.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Spastic Paraplegia 33, Autosomal Dominant 1 0.0 0.0
Disease Target Count P-value
adult high grade glioma 3801 1.6e-06
osteosarcoma 7950 2.4e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0
Disease Target Count Z-score Confidence
Paraplegia 74 4.894 2.4
Clubfoot 39 3.008 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-06
osteosarcoma -1.612 2.4e-06

Gene RIF (8)

AA Sequence

MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP      1 - 70
LCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRL     71 - 140
SRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNS    141 - 210
TLFLGNVEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTEDLTPGSVEEAEE    211 - 280
AEPDEEFKDAIEETHLVVLEDDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNC    281 - 350
TGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK             351 - 411
//

Text Mined References (17)

PMID Year Title