Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.96
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.400 0.003
non-small cell lung cancer 1.055 0.000
subependymal giant cell astrocytoma -1.417 0.036
Pick disease -2.700 0.000
progressive supranuclear palsy -2.400 0.007

Synonym

Accession Q5T4B2 A7MD00 C4AMA2 Q0VDF3 Q2VPJ4 Q4KMP2 Q5T4B1 Q8N107 Q96EZ5 Q9P226 Q9UMW5
Symbols CEECAM1
GLT25D3

Gene

PANTHER Protein Class (2)

AA Sequence

MRAARAAPLLQLLLLLGPWLEAAGVAESPLPAVVLAILARNAEHSLPHYLGALERLDYPRARMALWCATD      1 - 70
HNVDNTTEMLQEWLAAVGDDYAAVVWRPEGEPRFYPDEEGPKHWTKERHQFLMELKQEALTFARNWGADY     71 - 140
ILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTYYSNFWCGITPQGYYRRTAEYFPTKNRQRRGCFRV    141 - 210
PMVHSTFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGL    211 - 280
EDERVNFIHLILEALVDGPRMQASAHVTRPSKRPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRV    281 - 350
VDAVDGWMLNSSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFE    351 - 420
SNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALRLAGARKLLAS    421 - 490
QPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDDSG    491 - 560
RLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL                                       561 - 595
//

Text Mined References (7)

PMID Year Title
19075007 2009 Core glycosylation of collagen is initiated by two beta(1-O)galactosyltransferases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10608765 2000 Cerebral cell adhesion molecule: a novel leukocyte adhesion determinant on blood-brain barrier capillary endothelium.