Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.20
PubTator Score 16.30

Knowledge Summary


No data available




Accession Q5T481 A6NIP5 B5A868 Q5JVI1


  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (11)

26604136 RBM20 familial dilated cardiomyopathy is a developmental disorder initiated by molecular defects that pattern maladaptive cellular mechanisms of pathological cardiac remodeling.
24960161 In failing hearts, reduced expression of RBM20 affected alternative splicing of several direct targets, indicating that differences in RBM20 expression may affect cardiac function.
24584570 Study demonstrates that Rbm20 is expressed in early cardiogenesis and functions in the patterning of cardiac gene expression.
23886709 Nuclear retention domains have been identified in RBM20 which is a nuclear protein regulating alternative splicing of expressed genes.
23861363 The RBM20 c.1907 G>A (p.Arg636His) was confirmed in all 3 affected subjects who underwent exome sequencing.
22466703 Deep sequencing of the human and rat cardiac transcriptome revealed an RBM20-dependent regulation of alternative splicing
22004663 Mutations in RBM20 identified in approximately 3% of individuals with dilated cardiomyopathy. Mutations in RBM20 did not adversely affect survival or ventricular arrhythmias in subjects with dilated cardiomyopathy.
20590677 Dilated cardiomyopathy in patients with RBM20 mutations is associated with advanced disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19712805 RBM20 missense mutation is a novel gene underlying one form of dilated cardiomyopathy

AA Sequence

QKYLSQLAEEGLKETEGADSPRPEDSGIVPRFERKKL                                    1191 - 1227

Text Mined References (15)

PMID Year Title
26604136 2016 Modeling structural and functional deficiencies of RBM20 familial dilated cardiomyopathy using human induced pluripotent stem cells.
24960161 2014 RNA-binding protein RBM20 represses splicing to orchestrate cardiac pre-mRNA processing.
24584570 2014 Rbm20-deficient cardiogenesis reveals early disruption of RNA processing and sarcomere remodeling establishing a developmental etiology for dilated cardiomyopathy.
23886709 2013 Identification of nuclear retention domains in the RBM20 protein.
23861363 2013 Whole exome sequencing identifies a causal RBM20 mutation in a large pedigree with familial dilated cardiomyopathy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22561820 2012 King of hearts: a splicing factor rules cardiac proteins.
22466703 2012 RBM20, a gene for hereditary cardiomyopathy, regulates titin splicing.
22004663 2012 Genetic variation in the alternative splicing regulator RBM20 is associated with dilated cardiomyopathy.
21846512 Clinical and mutational spectrum in a cohort of 105 unrelated patients with dilated cardiomyopathy.