Property Summary

NCBI Gene PubMed Count 29
PubMed Score 87.31
PubTator Score 51.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.100 7.6e-04
breast carcinoma -1.100 6.8e-06
lung adenocarcinoma -1.100 6.9e-07
psoriasis -1.200 7.5e-25

Gene RIF (19)

AA Sequence

MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGEAIYSDEQAKFTCNTRQPGCDNVCYDA      1 - 70
FAPLSHVRFWVFQIVVISTPSVMYLGYAVHRLARASEQERRRALRRRPGPRRAPRAHLPPPHAGWPEPAD     71 - 140
LGEEEPMLGLGEEEEEEETGAAEGAGEEAEEAGAEEACTKAVGADGKAAGTPGPTGQHDGRRRIQREGLM    141 - 210
RVYVAQLVARAAFEVAFLVGQYLLYGFEVRPFFPCSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLL    211 - 280
LNLCEMAHLGLGSAQDAVRGRRGPPASAPAPAPRPPPCAFPAAAAGLACPPDYSLVVRAAERARAHDQNL    281 - 350
ANLALQALRDGAAAGDRDRDSSPCVGLPAASRGPPRAGAPASRTGSATSAGTVGEQGRPGTHERPGAKPR    351 - 420
AGSEKGSASSRDGKTTVWI                                                       421 - 439
//

Text Mined References (26)

PMID Year Title