Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5T3Y7 Q5T552
Symbols C6orf112
bA99L11.2

Gene

 Compartment GO Term (0)

AA Sequence

MLRSTFTVHWTTILGICRPIKPIYKSQACPLSEKRNADNHLVSEDNTFKEPERYISSSCVLTSILYLGEK      1 - 70
TFSFRTLISPRGMKLVEILQQPSLTMVA                                               71 - 98
//

Text Mined References (3)

PMID Year Title
21654844 2011 Genome-wide association study of severity in multiple sclerosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14574404 2003 The DNA sequence and analysis of human chromosome 6.