Property Summary

NCBI Gene PubMed Count 26
Grant Count 13
R01 Count 3
Funding $847,985.13
PubMed Score 33.75
PubTator Score 38.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (19)

PMID Text
26655271 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10 and modulates cisplatin resistance.
24937672 ABCC10 expression is correlated with human breast cancer subtype using breast tissue microarrays.
24431074 the combination of paclitaxel and masitinib could serve as a novel and useful therapeutic strategy to reverse paclitaxel resistance mediated by ABCC10
23087055 This report describes the ATPase activity of ABCC10 and further revealed ABCC10 localizes basolaterally using an in vitro system. The described work also identifies the tyrosine kinase sorafenib as an inhibitor of ABCC10.
22739155 Tetrandrine and 5-bromotetrandrine can both reverse multidrug resistance in K562 cells by reducing expression of MRP7.
22082652 Multivariate regression analysis identified carriage of a composite genotype of ABCC10 rs2125739 to be associated with nevirapine plasma concentrations
21628669 Tenofovir is a substrate for ABCC10, and genetic variability within the ABCC10 gene may influence tenofovir renal tubular transport and contribute to the development of kidney tubular dysfunction.
21576088 Study establishes that ABCC10 is able to modulate taxane resistance in vivo using a mouse model.
19841739 Imatinib and nilotinib reverse multidrug resistance in cancer cells by inhibiting the efflux activity of the MRP7 (ABCC10)
19343046 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYILPCSPGWRLRL      1 - 70
AASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALWVLAHSPHGHSRGPLALALVA     71 - 140
LLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLAALLAYALGWAAPGGPREPWAQEPLLPEDQE    141 - 210
PEVAEDGESWLSRFSYAWLAPLLARGACGELRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGA    211 - 280
FGRCYLALGLLKLVGTMLGFSGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYK    281 - 350
VTLQARGAVLNILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG    351 - 420
VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQALGARVEACRA    421 - 490
RELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTALALVRMLILPLNNFPWVING    491 - 560
LLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLELHGALFSWDPVGTSLETFISHLEVKKGMLVG    561 - 630
IVGKVGCGKSSLLAAIAGELHRLRGHVAVRGLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLE    631 - 700
ACALNDDLSILPAGDQTEVGEKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCIL    701 - 770
GMLSYTTRLLCTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP    771 - 840
EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRNAADWWLSHWI    841 - 910
SQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNGSSDIRFYLTVYATIAGVNSL    911 - 980
CTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATPTGRILNRFSSDVACADDSLPFILNILLANA    981 - 1050
AGLLGLLAVLGSGLPWLLLLLPPLSIMYYHVQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRAT   1051 - 1120
GATYRFEEENLRLLELNQRCQFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSY   1121 - 1190
ALSLTGLLSGLVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP   1191 - 1260
NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLRSQLAIIPQEP   1261 - 1330
FLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGRSLSLGQRQLLCLARALLTDA   1331 - 1400
KILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRLNTILNSDRVLVLQAGRVVELDSPATLRNQP   1401 - 1470
HSLFQQLLQSSQQGVPASLGGP                                                   1471 - 1492
//

Text Mined References (29)

PMID Year Title
26655271 2016 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10.
24937672 2014 Abcc10 status affects mammary tumour growth, metastasis, and docetaxel treatment response.
24431074 2014 Masitinib antagonizes ATP-binding cassette subfamily C member 10-mediated paclitaxel resistance: a preclinical study.
23087055 2012 Modulation of the ATPase and transport activities of broad-acting multidrug resistance factor ABCC10 (MRP7).
22739155 2012 Mechanisms of tetrandrine and 5-bromotetrandrine in reversing multidrug resistance may relate to down-regulation of multidrug resistance associated protein 7 expression.
22082652 2012 Association of ABCC10 polymorphisms with nevirapine plasma concentrations in the German Competence Network for HIV/AIDS.
21628669 2011 Genetic variants of ABCC10, a novel tenofovir transporter, are associated with kidney tubular dysfunction.
21576088 2011 Contribution of Abcc10 (Mrp7) to in vivo paclitaxel resistance as assessed in Abcc10(-/-) mice.
19841739 2009 Imatinib and nilotinib reverse multidrug resistance in cancer cells by inhibiting the efflux activity of the MRP7 (ABCC10).
19720054 2010 Lapatinib and erlotinib are potent reversal agents for MRP7 (ABCC10)-mediated multidrug resistance.
More...