Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.86148196024568E-4
group 4 medulloblastoma 1875 5.82059481036759E-4
invasive ductal carcinoma 2950 0.00273843743605364
non diabetic and post-ischemic heart failure 200 0.00409276938344475
astrocytic glioma 2241 0.0136044374158108
oligodendroglioma 2849 0.0371301503657781
Disease Target Count Z-score Confidence
Hepatocellular Adenoma 10 3.622 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.400 0.014
oligodendroglioma -1.200 0.037
non diabetic and post-ischemic heart fai... -1.100 0.004
group 4 medulloblastoma -1.500 0.001
invasive ductal carcinoma 1.200 0.003
ovarian cancer 1.700 0.000

Synonym

Accession Q5T3I0 Q5T3I1 Q6ZUE7 Q8IWG8 Q9NXH4
Symbols GPATC4

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with G patch domain containing 4 (GPATCH4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFN      1 - 70
KTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSP     71 - 140
KILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDPGAPQLQSESKPPKKKKKKRR    141 - 210
QKEEEEATASERNDADEKHPEHAEQNIRKSKKKKRRHQEGKVSDEREGTTKGNEKEDAAGTSGLGELNSR    211 - 280
EQTNQSLRKGKKKKRWHHEEEKMGVLEEGGKGKEAAGSVRTEEVESRAYADPCSRRKKRQQQEEEDLNLE    281 - 350
DRGEETVLGGGTREAESRACSDGRSRKSKKKRQQHQEEEDILDVRDEKDGGAREAESRAHTGSSSRGKRK    351 - 420
RQQHPKKERAGVSTVQKAKKKQKKRD                                                421 - 446
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...