Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 2.3e-02
group 4 medulloblastoma -1.400 1.5e-04
invasive ductal carcinoma 1.200 2.7e-03
non diabetic and post-ischemic heart fai... -1.100 4.1e-03
oligodendroglioma -1.200 3.7e-02
ovarian cancer 1.700 2.9e-04

Gene RIF (3)

AA Sequence

MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFN      1 - 70
KTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSP     71 - 140
KILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDPGAPQLQSESKPPKKKKKKRR    141 - 210
QKEEEEATASERNDADEKHPEHAEQNIRKSKKKKRRHQEGKVSDEREGTTKGNEKEDAAGTSGLGELNSR    211 - 280
EQTNQSLRKGKKKKRWHHEEEKMGVLEEGGKGKEAAGSVRTEEVESRAYADPCSRRKKRQQQEEEDLNLE    281 - 350
DRGEETVLGGGTREAESRACSDGRSRKSKKKRQQHQEEEDILDVRDEKDGGAREAESRAHTGSSSRGKRK    351 - 420
RQQHPKKERAGVSTVQKAKKKQKKRD                                                421 - 446
//

Text Mined References (19)

PMID Year Title