Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 4.17074470498139E-5
osteosarcoma 7933 1.29050302020833E-4
lung cancer 4473 0.0206812907900129

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.098 0.000
lung cancer 1.100 0.021
group 3 medulloblastoma -1.400 0.000

AA Sequence

MQEMVRELWMWNVEEEEHEVGICTWGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRK      1 - 70
VSATSSIAVYPCPGQSSGGAESPAPGPGLAGWSHLCGAALAEVQAAPVSQAAVSDASLGPEWSQEGCRPG     71 - 140
LTSGQHGGRDGR                                                              141 - 152
//

Text Mined References (5)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.