Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 4104 4.2e-05
osteosarcoma 7950 1.3e-04
lung cancer 4740 2.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.400 4.2e-05
lung cancer 1.100 2.1e-02
osteosarcoma -1.098 1.3e-04

AA Sequence

MQEMVRELWMWNVEEEEHEVGICTWGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRK      1 - 70
VSATSSIAVYPCPGQSSGGAESPAPGPGLAGWSHLCGAALAEVQAAPVSQAAVSDASLGPEWSQEGCRPG     71 - 140
LTSGQHGGRDGR                                                              141 - 152
//

Text Mined References (5)

PMID Year Title