Property Summary

NCBI Gene PubMed Count 28
PubMed Score 1.34
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.036
urothelial carcinoma -1.600 0.032
astrocytic glioma -2.300 0.013
ependymoma -2.400 0.025
oligodendroglioma -2.200 0.021
glioblastoma -3.000 0.000
osteosarcoma -2.271 0.010
medulloblastoma -2.400 0.000
cystic fibrosis -2.874 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.300 0.001
primitive neuroectodermal tumor -2.200 0.006
intraductal papillary-mucinous adenoma (... -1.800 0.004
intraductal papillary-mucinous carcinoma... -1.700 0.035
pancreatic cancer -1.200 0.001
interstitial cystitis -2.500 0.000
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.600 0.000
subependymal giant cell astrocytoma -1.333 0.021
nasopharyngeal carcinoma -1.500 0.005
psoriasis 1.400 0.001
spina bifida -2.395 0.042
Breast cancer -1.200 0.008
ulcerative colitis -2.100 0.000
pituitary cancer -1.300 0.004

Synonym

Gene

PDB

3LRA   3O46  

Gene RIF (7)

PMID Text
27001270 MPP7 as a novel candidate gene for Primary open angle glaucoma.
22171069 The association of MPP7 single-nucleotide polymorphism rs4317882 gene variant with site-specific bone mineral density was determined.
20702775 The Dlg1-MPP7-Mals3 heterotrimer consists of 2 pairs of heterodimeric L27 domains. These 2 dimers are asymmetric due to the large difference between the N- and C-terminal tandem L27 domain of MPP7.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17332497 MPP7 targets to the lateral surface of epithelial cells via its L27N domain, through an interaction with Dlg1.
17237226 MPP7 is a PDZ protein that interacts with human papillomavirus-16 E6 and forms a tripartite complex with LIN7A or LIN7C and DLG1, regulating the stability and localization of DLG1 to cell junctions.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILH      1 - 70
GAAALADDLAEELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQKNYDPVLPPMPEDIDDEEDSVKII     71 - 140
RLVKNREPLGATIKKDEQTGAIIVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIQILAQSQG    141 - 210
AITFKIIPGSKEETPSKEGKMFIKALFDYNPNEDKAIPCKEAGLSFKKGDILQIMSQDDATWWQAKHEAD    211 - 280
ANPRAGLIPSKHFQERRLALRRPEILVQPLKVSNRKSSGFRKSFRLSRKDKKTNKSMYECKKSDQYDTAD    281 - 350
VPTYEEVTPYRRQTNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTVPHTTRARRSQESDGVEYIFI    351 - 420
SKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPS    421 - 490
IERLRETRKNAKIISSRDDQGAAKPFTEEDFQEMIKSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFD    491 - 560
KLETETHWVPVSWLHS                                                          561 - 576
//

Text Mined References (33)

PMID Year Title
27001270 2016 Genetic association and stress mediated down-regulation in trabecular meshwork implicates MPP7 as a novel candidate gene in primary open angle glaucoma.
26109466 2015 Molecular classification of idiopathic pulmonary fibrosis: personalized medicine, genetics and biomarkers.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25073539 2014 Interstitial 10p11.23-p12.1 microdeletions associated with developmental delay, craniofacial abnormalities, and cryptorchidism.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24877562 2014 Human endometrial DNA methylome is cycle-dependent and is associated with gene expression regulation.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24038936 2013 Clinical significance of de novo and inherited copy-number variation.
23951440 2012 Evidence mounts that MPP7 is a susceptibility gene for osteoporosis.
More...