Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5T2Q4
Symbols CCNYL2P
C10orf21
bA178A10.2

Gene

 Compartment GO Term (0)

AA Sequence

MGNILTCCVCPRASPGLHQHQGLVCHCESEIYEAAAGDLIAGVPVAAAVEPGEVTFVAGEGLHMHHICER      1 - 70
EMPEDIPLEPNPSDHPKASTIFLRKSQTDVQEKKKKQLCKVSTEHFTQQYSSCSTIFLDDSIASQPHLTM     71 - 140
TLKSCDLGTILSYQAKRDAHRSLGIFDEQLHPLTVRKEVLEEYFKYDPEHKLIFRFVRTLFKAMRLTAEF    141 - 210
AIVSLIYIERLVSYADIDICPTNWKRIVLGAILLASKVWSDMAVWNEDYCKLFKNITVEEMNELERQFLK    211 - 280
LINYNNSITNSVYSRFYFDLRTLAHNNGLYSPVYLLDRERAWKLEAFSRMEQDKVFYSAAKNGSLSADDL    281 - 350
IHLQRAKAILF                                                               351 - 361
//

Text Mined References (2)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.