Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.6e-03
medulloblastoma, large-cell -1.100 1.4e-03
osteosarcoma -1.598 3.1e-07
ovarian cancer -1.500 4.7e-11
tuberculosis and treatment for 6 months 1.700 3.4e-05

Gene RIF (1)

AA Sequence

MAQVEKRGGLLRKSSASKKPLKEKVVLMYDEIFMTEDPSKCSPRFWEELFLMKVNLEYLEGKLESLDGEE      1 - 70
LMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSGFDIINMLMGFDKAELCMKNL     71 - 140
MESLDSLLCAEGSESLKSLCLKLLLCLVTVTDNISQNTILEYVMINSIFEAILQILSHPPSRREHGYDAV    141 - 210
VLLALLVNYRKYESVNPYIVKLSIVDDEATLNGMGLVIAQALSEYNRQYKDKEEEHQSGFFSALTNMVGS    211 - 280
MFIADAHEKISVQTNEAILLALYEAVHLNRNFITVLAQSHPEMGLVTTPVSPAPTTPVTPLGTTPPSSDV    281 - 350
ISSVELPLDADVQTSNLLITFLKYSSIVMQDTKDEHRLHSGKLCLIILTCIAEDQYANAFLHDDNMNFRV    351 - 420
NLHRMPMRHRKKAADKNLPCRPLVCAVLDLMVEFIVTHMMKEFPMDLYIRCIQVVHKLLCYQKKCRVRLH    421 - 490
YTWRELWSALINLLKFLMSNETVLLAKHNIFTLALMIVNLFNMFITYGDTFLPTPSSYDELYYEIIRMHQ    491 - 560
SFDNLYSMVLRLSTNAGQWKEAASKVTHALVNIRAIINHFNPKIESYAAVNHISQLSEEQVLEVVRANYD    561 - 630
TLTLKLQDGLDQYERYSEQHKEAAFFKELVRSISTNVRRNLAFHTLSQEVLLKEFSTIS               631 - 689
//

Text Mined References (10)

PMID Year Title