Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.37
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 0.001
oligodendroglioma -1.300 0.002
posterior fossa group B ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.400 0.000
adult high grade glioma -1.400 0.000
subependymal giant cell astrocytoma -1.456 0.014
Pick disease -1.100 0.000
ovarian cancer -1.200 0.000

Gene RIF (3)

PMID Text
26280536 OTUD3 is an essential regulator of PTEN and the OTUD3-PTEN signalling axis plays a critical role in tumour suppression.
23511034 Single-nucleotide polymorphism in OTUD3 gene is associated with ulcerative colitis.
18187620 Knockdown of OTU domain containing 3 (OTUD3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSRKQAAKSRPGSGSRKAEAERKRDERAARRALAKERRNRPESGGGGGCEEEFVSFANQLQALGLKLREV      1 - 70
PGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIV     71 - 140
AFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQDE    141 - 210
SNKREKIKTKGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNA    211 - 280
EENLEPSGRVLKQCGPLWEEGGSGARIFGNQGLNEGRTENNKAQASPSEENKANKNQLAKVTNKQRREQQ    281 - 350
WMEKKKRQEERHRHKALESRGSHRDNNRSEAEANTQVTLVKTFAALNI                          351 - 398
//

Text Mined References (13)

PMID Year Title
26280536 2015 Deubiquitylase OTUD3 regulates PTEN stability and suppresses tumorigenesis.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20228798 2010 Genome-wide association study for ulcerative colitis identifies risk loci at 7q22 and 22q13 (IL17REL).
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...