Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.36
PubTator Score 7.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.090909684278E-29

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 0.000

Synonym

Accession Q5T2D2 Q08AP8 Q08AP9 Q8IWY0 Q9H8E9 TLT-2
Symbols TLT2
TLT-2
C6orf76
dJ238O23.1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (5)

PMID Text
24439484 Missense variant in TREML2 protects against Alzheimer's disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19544488 Data do not point to a role for TREML2 as a receptor for B7-H3.
18650384 analysis of an interaction between B7-H3 and TLT-2 that preferentially enhances CD8(+) T cell activation
16670310 TLT2 may be involved in the innate immune response based on its expression profile and the fact that it is up-regulated in response to inflammation.

AA Sequence

MAPAFLLLLLLWPQGCVSGPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFARV      1 - 70
WVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDN     71 - 140
ILKSGTVTTGQAPTSGPDAPFTTGVMVFTPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQT    141 - 210
VTASPSNARDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYSTVLGVVLTLLVL    211 - 280
MLIMVYGFWKKRHMASYSMCSDPSTRDPPGRPEPYVEVYLI                                 281 - 321
//

Text Mined References (13)

PMID Year Title
24439484 2014 Missense variant in TREML2 protects against Alzheimer's disease.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19544488 2009 B7-H3 is a potent inhibitor of human T-cell activation: No evidence for B7-H3 and TREML2 interaction.
18650384 2008 Triggering receptor expressed on myeloid cell-like transcript 2 (TLT-2) is a counter-receptor for B7-H3 and enhances T cell responses.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16670310 2006 Trem-like transcript 2 is expressed on cells of the myeloid/granuloid and B lymphoid lineage and is up-regulated in response to inflammation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...