Property Summary

NCBI Gene PubMed Count 12
Grant Count 12
R01 Count 3
Funding $1,336,472.1
PubMed Score 8.36
PubTator Score 7.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 0.000

Gene RIF (5)

PMID Text
24439484 Missense variant in TREML2 protects against Alzheimer's disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19544488 Data do not point to a role for TREML2 as a receptor for B7-H3.
18650384 analysis of an interaction between B7-H3 and TLT-2 that preferentially enhances CD8(+) T cell activation
16670310 TLT2 may be involved in the innate immune response based on its expression profile and the fact that it is up-regulated in response to inflammation.

AA Sequence

MAPAFLLLLLLWPQGCVSGPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFARV      1 - 70
WVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDN     71 - 140
ILKSGTVTTGQAPTSGPDAPFTTGVMVFTPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQT    141 - 210
VTASPSNARDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYSTVLGVVLTLLVL    211 - 280
MLIMVYGFWKKRHMASYSMCSDPSTRDPPGRPEPYVEVYLI                                 281 - 321
//

Text Mined References (13)

PMID Year Title
24439484 2014 Missense variant in TREML2 protects against Alzheimer's disease.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19544488 2009 B7-H3 is a potent inhibitor of human T-cell activation: No evidence for B7-H3 and TREML2 interaction.
18650384 2008 Triggering receptor expressed on myeloid cell-like transcript 2 (TLT-2) is a counter-receptor for B7-H3 and enhances T cell responses.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16670310 2006 Trem-like transcript 2 is expressed on cells of the myeloid/granuloid and B lymphoid lineage and is up-regulated in response to inflammation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...