Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.49
PubTator Score 7.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.1e-29

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 2.1e-29

Gene RIF (7)

AA Sequence

MAPAFLLLLLLWPQGCVSGPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFARV      1 - 70
WVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDN     71 - 140
ILKSGTVTTGQAPTSGPDAPFTTGVMVFTPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQT    141 - 210
VTASPSNARDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYSTVLGVVLTLLVL    211 - 280
MLIMVYGFWKKRHMASYSMCSDPSTRDPPGRPEPYVEVYLI                                 281 - 321
//

Text Mined References (15)

PMID Year Title