Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.03

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MNLGVSMLRILFLLDVGGAQVLATGKTPGAEIDFKYALIGTAVGVAISAGFLALKICMIRRHLFDDDSSD      1 - 70
LKSTPGGLSDTIPLKKRAPRRNHNFSKRDAQVIEL                                        71 - 105
//

Text Mined References (5)

PMID Year Title