Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 7.55094092755593E-22
lung adenocarcinoma 2714 3.16502417524255E-12
chronic lymphosyte leukemia 232 3.35193747786987E-8
ulcerative colitis 2087 1.68263816187374E-5
interstitial cystitis 2299 2.10626595832809E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.84647822561185E-5
primary Sjogren syndrome 789 3.47273914871504E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.21275776799466E-4
tuberculosis and treatment for 6 months 686 9.2814965221887E-4
invasive ductal carcinoma 2950 0.00458571218329215
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0092926649340773
osteosarcoma 7933 0.0156387091026714

Expression

AA Sequence

MNLGVSMLRILFLLDVGGAQVLATGKTPGAEIDFKYALIGTAVGVAISAGFLALKICMIRRHLFDDDSSD      1 - 70
LKSTPGGLSDTIPLKKRAPRRNHNFSKRDAQVIEL                                        71 - 105
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.