Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.5e-06
lung cancer 4740 1.6e-03
subependymal giant cell astrocytoma 2287 1.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 1.6e-03
osteosarcoma -2.205 3.5e-06
subependymal giant cell astrocytoma 1.128 1.8e-02

Gene RIF (1)

AA Sequence

MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRG      1 - 70
RPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACV     71 - 140
QLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCG    141 - 210
MKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQ    211 - 280
DGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRT    281 - 350
IRTEEAILISLAALQPGLIQAGARHT                                                351 - 376
//

Text Mined References (12)

PMID Year Title