Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.205 0.000
lung cancer 1.500 0.002
subependymal giant cell astrocytoma 1.128 0.018

Synonym

Accession Q5T280 Q0D2P6 Q6P469 Q6PGP9 Q6PIJ1 Q6PJV9
Symbols CENP-32
HSPC109
C9orf114

Gene

PDB

4RG1  

Gene RIF (1)

PMID Text
25657325 CENP-32 appears to be required for centrosomes to integrate into a fully functional spindle that not only nucleates astral microtubules, but also is able to nucleate and bind to kinetochore and central spindle microtubules.

AA Sequence

MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRG      1 - 70
RPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACV     71 - 140
QLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCG    141 - 210
MKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQ    211 - 280
DGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRT    281 - 350
IRTEEAILISLAALQPGLIQAGARHT                                                351 - 376
//

Text Mined References (11)

PMID Year Title
25657325 2015 CENP-32 is required to maintain centrosomal dominance in bipolar spindle assembly.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
More...