Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 3.4704757924375E-6
lung cancer 4473 0.00158160938978979
subependymal giant cell astrocytoma 2287 0.0177314241152866
Disease Target Count Z-score Confidence
Skin carcinoma 3 3.011 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.205 0.000
lung cancer 1.500 0.002
subependymal giant cell astrocytoma 1.128 0.018

Synonym

Accession Q5T280 Q0D2P6 Q6P469 Q6PGP9 Q6PIJ1 Q6PJV9
Symbols CENP-32
HSPC109
C9orf114

Gene

PDB

4RG1  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (1)

PMID Text
25657325 CENP-32 appears to be required for centrosomes to integrate into a fully functional spindle that not only nucleates astral microtubules, but also is able to nucleate and bind to kinetochore and central spindle microtubules.

AA Sequence

MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRG      1 - 70
RPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACV     71 - 140
QLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCG    141 - 210
MKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQ    211 - 280
DGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRT    281 - 350
IRTEEAILISLAALQPGLIQAGARHT                                                351 - 376
//

Text Mined References (11)

PMID Year Title
25657325 2015 CENP-32 is required to maintain centrosomal dominance in bipolar spindle assembly.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
More...