Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.44
PubTator Score 1.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.200 0.006
pancreatic cancer 1.100 0.021
medulloblastoma, large-cell 1.100 0.000
Crohn's disease -1.024 0.000
ulcerative colitis -1.080 0.003
tuberculosis and treatment for 6 months -1.400 0.001
lung cancer 1.600 0.012
pancreatic carcinoma 1.100 0.021
ovarian cancer 2.100 0.000

Synonym

Accession Q5T200 A2A323 O94936 Q5T1Z9 Q7Z7J3 Q8NDT6 Q9H0L6
Symbols KIAA0853

Gene

Gene RIF (1)

PMID Text
24507884 This study identified ZC3H13 significantly associated loci with a biologically plausible role in schizophrenia.

AA Sequence

MSKIRRKVTVENTKTISDSTSRRPSVFERLGPSTGSTAETQCRNWLKTGNCLYGNTCRFVHGPSPRGKGY      1 - 70
SSNYRRSPERPTGDLRERMKNKRQDVDTEPQKRNTEESSSPVRKESSRGRHREKEDIKITKERTPESEEE     71 - 140
NVEWETNRDDSDNGDINYDYVHELSLEMKRQKIQRELMKLEQENMEKREEIIIKKEVSPEVVRSKLSPSP    141 - 210
SLRKSSKSPKRKSSPKSSSASKKDRKTSAVSSPLLDQQRNSKTNQSKKKGPRTPSPPPPIPEDIALGKKY    211 - 280
KEKYKVKDRIEEKTRDGKDRGRDFERQREKRDKPRSTSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPR    281 - 350
RKRTPSPSYQRTLTPPLRRSASPYPSHSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDT    351 - 420
RGKRDREKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTK    421 - 490
ESRDPRDSRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESSRTEIRNESRNESRSEIRNDRM    491 - 560
GRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWETRSSYPERDRYPERDNRDQARDSSFERRHGERD    561 - 630
RRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDRE    631 - 700
REKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREERERERERERERERER    701 - 770
ERERERARERDKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDERKSKKRYRNEGSPSPRQSPKR    771 - 840
RREHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKPERKESSRRYEEQEL    841 - 910
KEKVSSVDKQREQTEILESSRMRAQDIIGHHQSEDRETSDRAHDENKKKAKIQKKPIKKKKEDDVGIERG    911 - 980
NIETTSEDGQVFSPKKGQKKKSIEKKRKKSKGDSDISDEEAAQQSKKKRGPRTPPITTKEELVEMCNGKN    981 - 1050
GILEDSQKKEDTAFSDWSDEDVPDRTEVTEAEHTATATTPGSTPSPLSSLLPPPPPVATATATTVPATLA   1051 - 1120
ATTAAAATSFSTSAITISTSATPTNTTNNTFANEDSHRKCHRTRVEKVETPHVTIEDAQHRKPMDQKRSS   1121 - 1190
SLGSNRSNRSHTSGRLRSPSNDSAHRSGDDQSGRKRVLHSGSRDREKTKSLEITGERKSRIDQLKRGEPS   1191 - 1260
RSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERERERRDTRQREWDRDADKD   1261 - 1330
WPRNRDRDRLRERERERERDKRRDLDRERERLISDSVERDRDRDRDRTFESSQIESVKRCEAKLEGEHER   1331 - 1400
DLESTSRDSLALDKERMDKDLGSVQGFEETNKSERTESLEGDDESKLDDAHSLGSGAGEGYEPISDDELD   1401 - 1470
EILAGDAEKREDQQDEEKMPDPLDVIDVDWSGLMPKHPKEPREPGAALLKFTPGAVMLRVGISKKLAGSE   1471 - 1540
LFAKVKETCQRLLEKPKDADNLFEHELGALNMAALLRKEERASLLSNLGPCCKALCFRRDSAIRKQLVKN   1541 - 1610
EKGTIKQAYTSAPMVDNELLRLSLRLFKRKTTCHAPGHEKTEDNKLSQSSIQQELCVS               1611 - 1668
//

Text Mined References (29)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24507884 2014 Combined analysis of exon splicing and genome wide polymorphism data predict schizophrenia risk loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
More...