Property Summary

NCBI Gene PubMed Count 4
Grant Count 6
R01 Count 6
Funding $720,854
PubMed Score 70.78
PubTator Score 25.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Gene RIF (1)

PMID Text
18650334 This study identified an evolutionarily conserved novel component of myelin called Mp11. The Mp11 genomic locus contains multiple conserved Egr binding sites, and Mp11 induction is regulated by the expression of Egr2 and expression in peripheral nerve.

AA Sequence

MTTATPLGDTTFFSLNMTTRGEDFLYKSSGAIVAAVVVVVIIIFTVVLILLKMYNRKMRTRRELEPKGPK      1 - 70
PTAPSAVGPNSNGSQHPATVTFSPVDVQVETR                                           71 - 102
//

Text Mined References (4)

PMID Year Title
18650334 2008 Analysis of peripheral nerve expression profiles identifies a novel myelin glycoprotein, MP11.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.