Property Summary

NCBI Gene PubMed Count 23
Grant Count 25
R01 Count 16
Funding $2,440,601.66
PubMed Score 47.11
PubTator Score 29.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (11)

PMID Text
23500015 Transdifferentiation of VSMC into calcifying vascular cells is enhanced by LPC and attenuated by Schnurri-3.
23178823 ZAS3 expression is directly regulated by estrogen and is overexpressed in lupus. Its upregulation by estrogen could play a critical role in female-biased autoimmune disorders.
21524353 The inhibitory effect of ZAS3 on NF-kappa B activity is mediated by neither direct association with N-kappa B nor disrupting nuclear localization of NFvarkappaB.
21189157 DNA competition by ZAS3 is sufficient to repress transcription activated by NF-kappaB and that ZAS3 is an endogenous kappaB-motif competitor with ininsic repression activity.
20732416 An interaction between ZAS3 and Smad proteins enhances transforming growth factor beta signaling.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17388942 Observational study of gene-disease association. (HuGE Navigator)
17388942 Single nucleotide polymorphisms strongly support HIVEP3 as a candidate for PARK10 in Parkinson disease.
More...

AA Sequence

MDPEQSVKGTKKAEGSPRKRLTKGEAIQTSVSSSVPYPGSGTAATQESPAQELLAPQPFPGPSSVLREGS      1 - 70
QEKTGQQQKPPKRPPIEASVHISQLPQHPLTPAFMSPGKPEHLLEGSTWQLVDPMRPGPSGSFVAPGLHP     71 - 140
QSQLLPSHASIIPPEDLPGVPKVFVPRPSQVSLKPTEEAHKKERKPQKPGKYICQYCSRPCAKPSVLQKH    141 - 210
IRSHTGERPYPCGPCGFSFKTKSNLYKHRKSHAHRIKAGLASGMGGEMYPHGLEMERIPGEEFEEPTEGE    211 - 280
STDSEEETSATSGHPAELSPRPKQPLLSSGLYSSGSHSSSHERCSLSQSSTAQSLEDPPPFVEPSSEHPL    281 - 350
SHKPEDTHTIKQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESAEQQVSPPNTNAKSYAEIIFG    351 - 420
KCGRIGQRTAMLTATSTQPLLPLSTEDKPSLVPLSVPRTQVIEHITKLITINEAVVDTSEIDSVKPRRSS    421 - 490
LSRRSSMESPKSSLYREPLSSHSEKTKPEQSLLSLQHPPSTAPPVPLLRSHSMPSAACTISTPHHPFRGS    491 - 560
YSFDDHITDSEALSHSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTK    561 - 630
KTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMH    631 - 700
YKLGTTLELTPLRKRRKEKSLGDEEEPPAFESTKSQFGSPGPSDAARNLPLESTKSPAEPSKSVPSLEGP    701 - 770
TGFQPRTPKPGSGSESGKERRTTSKEISVIQHTSSFEKSDSLEQPSGLEGEDKPLAQFPSPPPAPHGRSA    771 - 840
HSLQPKLVRQPNIQVPEILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEKLPPKKKRLRL    841 - 910
AEMAQSSGESSFESSVPLSRSPSQESNVSLSGSSRSASFERDDHGKAEAPSPSSDMRPKPLGTHMLTVPS    911 - 980
HHPHAREMRRSASEQSPNVSHSAHMTETRSKSFDYGSLSLTGPSAPAPVAPPARVAPPERRKCFLVRQAS    981 - 1050
LSRPPESELEVAPKGRQESEEPQPSSSKPSAKSSLSQISSAATSHGGPPGGKGPGQDRPPLGPTVPYTEA   1051 - 1120
LQVFHHPVAQTPLHEKPYLPPPVSLFSFQHLVQHEPGQSPEFFSTQAMSSLLSSPYSMPPLPPSLFQAPP   1121 - 1190
LPLQPTVLHPGQLHLPQLMPHPANIPFRQPPSFLPMPYPTSSALSSGFFLPLQSQFALQLPGDVESHLPQ   1191 - 1260
IKTSLAPLATGSAGLSPSTEYSSDIRLPPVAPPASSSAPTSAPPLALPACPDTMVSLVVPVRVQTNMPSY   1261 - 1330
GSAMYTTLSQILVTQSQGSSATVALPKFEEPPSKGTTVCGADVHEVGPGPSGLSEEQSRAFPTPYLRVPV   1331 - 1400
TLPERKGTSLSSESILSLEGSSSTAGGSKRVLSPAGSLELTMETQQQKRVKEEEASKADEKLELVKPCSV   1401 - 1470
VLTSTEDGKRPEKSHLGNQGQGRRELEMLSSLSSDPSDTKEIPPLPHPALSHGTAPGSEALKEYPQPSGK   1471 - 1540
PHRRGLTPLSVKKEDSKEQPDLPSLAPPSSLPLSETSSRPAKSQEGTDSKKVLQFPSLHTTTNVSWCYLN   1541 - 1610
YIKPNHIQHADRRSSVYAGWCISLYNPNLPGVSTKAALSLLRSKQKVSKETYTMATAPHPEAGRLVPSSS   1611 - 1680
RKPRMTEVHLPSLVSPEGQKDLARVEKEEERRGEPEEDAPASQRGEPARIKIFEGGYKSNEEYVYVRGRG   1681 - 1750
RGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTKHMKSKAHSKKCQETGVLEELE   1751 - 1820
AEEGTSDDLFQDSEGREGSEAVEEHQFSDLEDSDSDSDLDEDEDEDEEESQDELSRPSSEAPPPGPPHAL   1821 - 1890
RADSSPILGPQPPDAPASGTEATRGSSVSEAERLTASSCSMSSQSMPGLPWLGPAPLGSVEKDTGSALSY   1891 - 1960
KPVSPRRPWSPSKEAGSRPPLARKHSLTKNDSSPQRCSPAREPQASAPSPPGLHVDPGRGMGALPCGSPR   1961 - 2030
LQLSPLTLCPLGRELAPRAHVLSKLEGTTDPGLPRYSPTRRWSPGQAESPPRSAPPGKWALAGPGSPSAG   2031 - 2100
EHGPGLGLDPRVLFPPAPLPHKLLSRSPETCASPWQKAESRSPSCSPGPAHPLSSRPFSALHDFHGHILA   2101 - 2170
RTEENIFSHLPLHSQHLTRAPCPLIPIGGIQMVQARPGAHPTLLPGPTAAWVSGFSGGGSDLTGAREAQE   2171 - 2240
RGRWSPTESSSASVSPVAKVSKFTLSSELEGGDYPKERERTGGGPGRPPDWTPHGTGAPAEPTPTHSPCT   2241 - 2310
PPDTLPRPPQGRRAAQSWSPRLESPRAPTNPEPSATPPLDRSSSVGCLAEASARFPARTRNLSGEPRTRQ   2311 - 2380
DSPKPSGSGEPRAHPHQPEDRVPPNA                                               2381 - 2406
//

Text Mined References (27)

PMID Year Title
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23500015 2013 Effect of lyso-phosphatidylcholine and Schnurri-3 on osteogenic transdifferentiation of vascular smooth muscle cells to calcifying vascular cells in 3D culture.
23178823 2013 Novel estrogen target gene ZAS3 is overexpressed in systemic lupus erythematosus.
21524353 2011 ZAS3 promotes TNF?-induced apoptosis by blocking NF?B-activated expression of the anti-apoptotic genes TRAF1 and TRAF2.
21189157 2010 ZAS3 represses NF?B-dependent transcription by direct competition for DNA binding.
20732416 2011 ZAS3 accentuates transforming growth factor ? signaling in epithelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...