Property Summary

NCBI Gene PubMed Count 23
PubMed Score 47.11
PubTator Score 29.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.100 2.2e-03
astrocytic glioma -1.600 9.0e-03
ependymoma -2.200 1.3e-10
oligodendroglioma -1.800 6.3e-03
osteosarcoma 1.369 4.7e-06
glioblastoma -2.400 2.7e-04
medulloblastoma -2.000 3.9e-05
cystic fibrosis 1.009 6.9e-03
atypical teratoid / rhabdoid tumor -3.100 1.5e-07
medulloblastoma, large-cell -2.800 1.5e-04
primitive neuroectodermal tumor -1.700 7.1e-03
Atopic dermatitis 1.400 5.2e-03
intraductal papillary-mucinous adenoma (... -1.400 1.1e-02
intraductal papillary-mucinous carcinoma... -1.700 5.2e-03
intraductal papillary-mucinous neoplasm ... -1.300 4.6e-02
interstitial cystitis 1.300 2.7e-03
adult high grade glioma -2.100 5.5e-05
pilocytic astrocytoma -1.100 1.7e-02
Alzheimer's disease 1.200 1.9e-02
Pick disease 1.300 3.9e-04
progressive supranuclear palsy 1.100 1.5e-02
Breast cancer -1.300 1.7e-04
gastric carcinoma 1.200 3.4e-02
ulcerative colitis 1.600 5.5e-06
ovarian cancer -3.200 1.3e-15

Gene RIF (11)

PMID Text
23500015 Transdifferentiation of VSMC into calcifying vascular cells is enhanced by LPC and attenuated by Schnurri-3.
23178823 ZAS3 expression is directly regulated by estrogen and is overexpressed in lupus. Its upregulation by estrogen could play a critical role in female-biased autoimmune disorders.
21524353 The inhibitory effect of ZAS3 on NF-kappa B activity is mediated by neither direct association with N-kappa B nor disrupting nuclear localization of NFvarkappaB.
21189157 DNA competition by ZAS3 is sufficient to repress transcription activated by NF-kappaB and that ZAS3 is an endogenous kappaB-motif competitor with ininsic repression activity.
20732416 An interaction between ZAS3 and Smad proteins enhances transforming growth factor beta signaling.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17388942 Observational study of gene-disease association. (HuGE Navigator)
17388942 Single nucleotide polymorphisms strongly support HIVEP3 as a candidate for PARK10 in Parkinson disease.
14707112 Overexpression of KRC in transformed and primary T cells leads to increased IL-2 production.

AA Sequence

MDPEQSVKGTKKAEGSPRKRLTKGEAIQTSVSSSVPYPGSGTAATQESPAQELLAPQPFPGPSSVLREGS      1 - 70
QEKTGQQQKPPKRPPIEASVHISQLPQHPLTPAFMSPGKPEHLLEGSTWQLVDPMRPGPSGSFVAPGLHP     71 - 140
QSQLLPSHASIIPPEDLPGVPKVFVPRPSQVSLKPTEEAHKKERKPQKPGKYICQYCSRPCAKPSVLQKH    141 - 210
IRSHTGERPYPCGPCGFSFKTKSNLYKHRKSHAHRIKAGLASGMGGEMYPHGLEMERIPGEEFEEPTEGE    211 - 280
STDSEEETSATSGHPAELSPRPKQPLLSSGLYSSGSHSSSHERCSLSQSSTAQSLEDPPPFVEPSSEHPL    281 - 350
SHKPEDTHTIKQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESAEQQVSPPNTNAKSYAEIIFG    351 - 420
KCGRIGQRTAMLTATSTQPLLPLSTEDKPSLVPLSVPRTQVIEHITKLITINEAVVDTSEIDSVKPRRSS    421 - 490
LSRRSSMESPKSSLYREPLSSHSEKTKPEQSLLSLQHPPSTAPPVPLLRSHSMPSAACTISTPHHPFRGS    491 - 560
YSFDDHITDSEALSHSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTK    561 - 630
KTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMH    631 - 700
YKLGTTLELTPLRKRRKEKSLGDEEEPPAFESTKSQFGSPGPSDAARNLPLESTKSPAEPSKSVPSLEGP    701 - 770
TGFQPRTPKPGSGSESGKERRTTSKEISVIQHTSSFEKSDSLEQPSGLEGEDKPLAQFPSPPPAPHGRSA    771 - 840
HSLQPKLVRQPNIQVPEILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEKLPPKKKRLRL    841 - 910
AEMAQSSGESSFESSVPLSRSPSQESNVSLSGSSRSASFERDDHGKAEAPSPSSDMRPKPLGTHMLTVPS    911 - 980
HHPHAREMRRSASEQSPNVSHSAHMTETRSKSFDYGSLSLTGPSAPAPVAPPARVAPPERRKCFLVRQAS    981 - 1050
LSRPPESELEVAPKGRQESEEPQPSSSKPSAKSSLSQISSAATSHGGPPGGKGPGQDRPPLGPTVPYTEA   1051 - 1120
LQVFHHPVAQTPLHEKPYLPPPVSLFSFQHLVQHEPGQSPEFFSTQAMSSLLSSPYSMPPLPPSLFQAPP   1121 - 1190
LPLQPTVLHPGQLHLPQLMPHPANIPFRQPPSFLPMPYPTSSALSSGFFLPLQSQFALQLPGDVESHLPQ   1191 - 1260
IKTSLAPLATGSAGLSPSTEYSSDIRLPPVAPPASSSAPTSAPPLALPACPDTMVSLVVPVRVQTNMPSY   1261 - 1330
GSAMYTTLSQILVTQSQGSSATVALPKFEEPPSKGTTVCGADVHEVGPGPSGLSEEQSRAFPTPYLRVPV   1331 - 1400
TLPERKGTSLSSESILSLEGSSSTAGGSKRVLSPAGSLELTMETQQQKRVKEEEASKADEKLELVKPCSV   1401 - 1470
VLTSTEDGKRPEKSHLGNQGQGRRELEMLSSLSSDPSDTKEIPPLPHPALSHGTAPGSEALKEYPQPSGK   1471 - 1540
PHRRGLTPLSVKKEDSKEQPDLPSLAPPSSLPLSETSSRPAKSQEGTDSKKVLQFPSLHTTTNVSWCYLN   1541 - 1610
YIKPNHIQHADRRSSVYAGWCISLYNPNLPGVSTKAALSLLRSKQKVSKETYTMATAPHPEAGRLVPSSS   1611 - 1680
RKPRMTEVHLPSLVSPEGQKDLARVEKEEERRGEPEEDAPASQRGEPARIKIFEGGYKSNEEYVYVRGRG   1681 - 1750
RGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTKHMKSKAHSKKCQETGVLEELE   1751 - 1820
AEEGTSDDLFQDSEGREGSEAVEEHQFSDLEDSDSDSDLDEDEDEDEEESQDELSRPSSEAPPPGPPHAL   1821 - 1890
RADSSPILGPQPPDAPASGTEATRGSSVSEAERLTASSCSMSSQSMPGLPWLGPAPLGSVEKDTGSALSY   1891 - 1960
KPVSPRRPWSPSKEAGSRPPLARKHSLTKNDSSPQRCSPAREPQASAPSPPGLHVDPGRGMGALPCGSPR   1961 - 2030
LQLSPLTLCPLGRELAPRAHVLSKLEGTTDPGLPRYSPTRRWSPGQAESPPRSAPPGKWALAGPGSPSAG   2031 - 2100
EHGPGLGLDPRVLFPPAPLPHKLLSRSPETCASPWQKAESRSPSCSPGPAHPLSSRPFSALHDFHGHILA   2101 - 2170
RTEENIFSHLPLHSQHLTRAPCPLIPIGGIQMVQARPGAHPTLLPGPTAAWVSGFSGGGSDLTGAREAQE   2171 - 2240
RGRWSPTESSSASVSPVAKVSKFTLSSELEGGDYPKERERTGGGPGRPPDWTPHGTGAPAEPTPTHSPCT   2241 - 2310
PPDTLPRPPQGRRAAQSWSPRLESPRAPTNPEPSATPPLDRSSSVGCLAEASARFPARTRNLSGEPRTRQ   2311 - 2380
DSPKPSGSGEPRAHPHQPEDRVPPNA                                               2381 - 2406
//

Text Mined References (27)

PMID Year Title
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23500015 2013 Effect of lyso-phosphatidylcholine and Schnurri-3 on osteogenic transdifferentiation of vascular smooth muscle cells to calcifying vascular cells in 3D culture.
23178823 2013 Novel estrogen target gene ZAS3 is overexpressed in systemic lupus erythematosus.
21524353 2011 ZAS3 promotes TNF?-induced apoptosis by blocking NF?B-activated expression of the anti-apoptotic genes TRAF1 and TRAF2.
21189157 2010 ZAS3 represses NF?B-dependent transcription by direct competition for DNA binding.
20732416 2011 ZAS3 accentuates transforming growth factor ? signaling in epithelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17388942 2007 Investigation of the PARK10 gene in Parkinson disease.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15790681 2005 Foxp3 interacts with nuclear factor of activated T cells and NF-kappa B to repress cytokine gene expression and effector functions of T helper cells.
15627499 2005 Structural characterization of the gene encoding the large zinc finger protein ZAS3: implication to the origin of multiple promoters in eukaryotic genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14999091 2004 RING1 inhibits transactivation of RBP-J by Notch through interaction with LIM protein KyoT2.
14707112 2004 Schnurri-3 (KRC) interacts with c-Jun to regulate the IL-2 gene in T cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11804591 2002 A mammalian homolog of Drosophila schnurri, KRC, regulates TNF receptor-driven responses and interacts with TRAF2.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11161801 2001 Structure of the human zinc finger protein HIVEP3: molecular cloning, expression, exon-intron structure, and comparison with paralogous genes HIVEP1 and HIVEP2.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
2247438 1990 Two genes encode factors with NF-kappa B- and H2TF1-like DNA-binding properties.