Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5T1J6 A2RRD0 Q8N947
Symbols C20orf91
C20orf91A

Gene

 Compartment GO Term (0)

AA Sequence

MQGIDRWIPSIPPLQNHSAVNRRHFSAPQKLHADCEKEMLDGGVPGTTVRVSFDFSCLEMVRELWMWNVE      1 - 70
EEEHEVGISTWGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRKIAAQSEEWSCVLNK     71 - 140
ISTHPFVSKEHDGT                                                            141 - 154
//

Text Mined References (4)

PMID Year Title