Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $100,000
PubMed Score 36.30
PubTator Score 124.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.800 0.026
ependymoma 1.800 0.019
osteosarcoma -1.943 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000

Gene RIF (3)

PMID Text
18974390 Both CD4+ and CD8+ T-cell responses against COA-1 can occur in colorectal cancer patients with metastatic disease
16202387 The rat homolog of UBXD5 promotes RhoA activation through G12/13 heterotrimeric G proteins
11940653 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers

AA Sequence

MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPAS      1 - 70
HDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQV     71 - 140
REMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSEL    141 - 210
VVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNG    211 - 280
VPFKVSDLRNQVYLEDGLDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDI    281 - 350
RGPIRDTLQNCCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQAFLLMMQPDNTI    351 - 420
GDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGPCPGPG    421 - 490
PGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ                                            491 - 520
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18974390 2008 Induction of both CD8+ and CD4+ T-cell-mediated responses in colorectal cancer patients by colon antigen-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16202387 2005 Socius, a novel binding partner of Galpha12/13, promotes the Galpha12-induced RhoA activation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...