Property Summary

NCBI Gene PubMed Count 14
PubMed Score 36.30
PubTator Score 124.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.61487177599958E-7
atypical teratoid / rhabdoid tumor 4369 4.46004754726605E-4
ependymoma 2514 0.0193604867854351
Rheumatoid Arthritis 1171 0.025669027152258
Disease Target Count Z-score Confidence
Chronic granulomatous disease 13 3.205 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.800 0.026
ependymoma 1.800 0.019
osteosarcoma -1.943 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (3)

PMID Text
18974390 Both CD4+ and CD8+ T-cell responses against COA-1 can occur in colorectal cancer patients with metastatic disease
16202387 The rat homolog of UBXD5 promotes RhoA activation through G12/13 heterotrimeric G proteins
11940653 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers

AA Sequence

MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPAS      1 - 70
HDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQV     71 - 140
REMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSEL    141 - 210
VVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNG    211 - 280
VPFKVSDLRNQVYLEDGLDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDI    281 - 350
RGPIRDTLQNCCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQAFLLMMQPDNTI    351 - 420
GDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGPCPGPG    421 - 490
PGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ                                            491 - 520
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18974390 2008 Induction of both CD8+ and CD4+ T-cell-mediated responses in colorectal cancer patients by colon antigen-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16202387 2005 Socius, a novel binding partner of Galpha12/13, promotes the Galpha12-induced RhoA activation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...