Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.39
PubTator Score 4.89

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.41477513412785E-9
lung adenocarcinoma 2714 5.74070447281507E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0


  Differential Expression (2)

Disease log2 FC p
non-small cell lung carcinoma 1.700 0.000
lung adenocarcinoma 1.100 0.001


Accession Q5T0W9 Q2M1P3 Q96DQ2
Symbols C6orf143


  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (6)

25586059 FAM83B protein was increased in lung squamous cell carcinoma compared with lung adenocarcinoma or adjacent normal tissues, and that high-expression levels of FAM83B were associated with a high disease-free survival rate.
23912460 Suppression of PLD1 activity prevents FAM83B-mediated transformation.
23676467 ablation of FAM83B decreased p110alpha and AKT membrane localization, suppressed AKT phosphorylation, and diminished proliferation, AIG, and tumorigenicity in vivo.
22886302 FAM83B expression was significantly elevated in cancer and was associated with specific cancer subtypes, increased tumor grade, and decreased overall survival.
22082156 Knockdown of family with sequence similarity 83, member B (FAM83B) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

YNTGVYRSYQPNENKFRGFMQKFGNFIHKNK                                           981 - 1011

Text Mined References (14)

PMID Year Title
25586059 2015 FAM83B is a novel biomarker for diagnosis and prognosis of lung squamous cell carcinoma.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23912460 2014 Hyperactivation of EGFR and downstream effector phospholipase D1 by oncogenic FAM83B.
23676467 2013 FAM83B-mediated activation of PI3K/AKT and MAPK signaling cooperates to promote epithelial cell transformation and resistance to targeted therapies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22886302 2012 FAM83B mediates EGFR- and RAS-driven oncogenic transformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.