Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.45
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
non-small cell lung cancer 2890 2.9e-07
lung adenocarcinoma 2716 5.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Liver cancer 604 0.0 0.6
Melanoma 711 0.0 0.7
Skin cancer 469 0.0 0.7
Disease Target Count Z-score Confidence
Obesity 678 0.0 0.8
Type 2 diabetes mellitus 272 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.100 5.7e-04
non-small cell lung cancer 1.130 2.9e-07

Gene RIF (6)

AA Sequence

METSSMLSSLNDECKSDNYIEPHYKEWYRVAIDILIEHGLEAYQEFLVQERVSDFLAEEEINYILKNVQK      1 - 70
VAQSTAHGTDDSCDDTLSSGTYWPVESDVEAPNLDLGWPYVMPGLLGGTHIDLLFHPPRAHLLTIKETIR     71 - 140
KMIKEARKVIALVMDIFTDVDIFKEIVEASTRGVSVYILLDESNFNHFLNMTEKQGCSVQRLRNIRVRTV    141 - 210
KGQDYLSKTGAKFHGKMEQKFLLVDCQKVMYGSYSYMWSFEKAHLSMVQIITGQLVESFDEEFRTLYARS    211 - 280
CVPSSFAQEESARVKHGKALWENGTYQHSVSSLASVSSQRNLFGRQDKIHKLDSSYFKNRGIYTLNEHDK    281 - 350
YNIRSHGYKPHFVPNFNGPNAIRQFQPNQINENWKRHSYAGEQPETVPYLLLNRALNRTNNPPGNWKKPS    351 - 420
DSLSVASSSREGYVSHHNTPAQSFANRLAQRKTTNLADRNSNVRRSFNGTDNHIRFLQQRMPTLEHTTKS    421 - 490
FLRNWRIESYLNDHSEATPDSNGSALGDRFEGYDNPENLKANALYTHSRLRSSLVFKPTLPEQKEVNSCT    491 - 560
TGSSNSTIIGSQGSETPKEVPDTPTNVQHLTDKPLPESIPKLPLQSEAPKMHTLQVPENHSVALNQTTNG    561 - 630
HTESNNYIYKTLGVNKQTENLKNQQTENLLKRRSFPLFDNSKANLDPGNSKHYVYSTLTRNRVRQPEKPK    631 - 700
EDLLKSSKSMHNVTHNLEEDEEEVTKRNSPSGTTTKSVSIAALLDVNKEESNKELASKKEVKGSPSFLKK    701 - 770
GSQKLRSLLSLTPDKKENLSKNKAPAFYRLCSSSDTLVSEGEENQKPKKSDTKVDSSPRRKHSSSSNSQG    771 - 840
SIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKFLERAGDASAPRFNTEQIQYRDSREINAVVTPER    841 - 910
RPTSSPRPTSSELLRSHSTDRRVYSRFEPFCKIESSIQPTSNMPNTSINRPEIKSATMGNSYGRSSPLLN    911 - 980
YNTGVYRSYQPNENKFRGFMQKFGNFIHKNK                                           981 - 1011
//

Text Mined References (14)

PMID Year Title