Property Summary

NCBI Gene PubMed Count 27
PubMed Score 34.70
PubTator Score 13.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -2.800 2.7e-02
adrenocortical carcinoma 1.046 4.5e-03
astrocytoma 1.400 2.8e-02
dermatomyositis 1.600 1.4e-04
ependymoma 1.100 4.6e-05
esophageal adenocarcinoma 1.300 1.8e-02
group 3 medulloblastoma 1.800 1.1e-03
interstitial cystitis -1.600 1.2e-03
interstitial lung disease -1.300 4.0e-02
pancreatic cancer 1.300 1.8e-03
pancreatic carcinoma 1.300 1.8e-03
primitive neuroectodermal tumor 1.600 1.2e-03
psoriasis -1.600 7.2e-10
spina bifida -1.329 4.1e-02

Gene RIF (13)

AA Sequence

MSWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEEPRFTSCV      1 - 70
AFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKF     71 - 140
ERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQ    141 - 210
IYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGD    211 - 280
FPFEDYSQHIYRTISDGTISASKQESGKMDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGS    281 - 350
QFLTFSIEPVHYCMNEIKTGKPRIPSFRSLKRGWSVKMGPALEDFSHLPPEQRRKKLQQRIDELNRELQK    351 - 420
ESDQKDALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGGRGDRRHSSD    421 - 490
INHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHNEFDDEFEDDDPLPAIGHCKAIYPFDGHNEGTLAMK    491 - 560
EGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEKNSKGS                             561 - 605
//

Text Mined References (34)

PMID Year Title