Property Summary

NCBI Gene PubMed Count 26
PubMed Score 32.42
PubTator Score 13.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 5.02036024096394E-15
posterior fossa group A ependymoma 1511 1.56934022182159E-7
group 4 medulloblastoma 1875 3.77258589637737E-7
dermatomyositis 967 1.39287504153836E-4
interstitial cystitis 2299 0.00115297183220651
primitive neuroectodermal tumor 3031 0.00117037729935796
pancreatic cancer 2300 0.00180029936206534
pancreatic carcinoma 567 0.00180029936206534
adrenocortical carcinoma 1427 0.00454451822732109
esophageal adenocarcinoma 737 0.0176010007179145
acute myeloid leukemia 785 0.0265523687125971
astrocytoma 1493 0.0277642264665429
interstitial lung disease 292 0.0398377655694781
spina bifida 1064 0.0407734452079813
Disease Target Count Z-score Confidence
Wiskott-Aldrich syndrome 27 3.439 1.7

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer 1.300 0.002
interstitial lung disease -1.300 0.040
esophageal adenocarcinoma 1.300 0.018
psoriasis -1.800 0.000
posterior fossa group A ependymoma 1.400 0.000
group 4 medulloblastoma 2.400 0.000
astrocytoma 1.400 0.028
primitive neuroectodermal tumor 1.600 0.001
adrenocortical carcinoma 1.046 0.005
interstitial cystitis -1.600 0.001
pancreatic carcinoma 1.300 0.002
spina bifida -1.329 0.041
acute myeloid leukemia -2.800 0.027
dermatomyositis 1.600 0.000

Synonym

Accession Q5T0N5 J3QSS4 Q5T0N6 Q6B097 Q6P653 Q6R4Q4 Q9NXG1
Symbols TOCA1
C1orf39

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (12)

PMID Text
25547174 Loss of p53 tumor suppressor function in breast cancers leads to upregulation of Toca-1, and results in enhanced risk of developing metastatic disease.
23358156 GWAS results show that the aggregate effects of common SNPs explain 22-46% of phenotypic variation in childhood intelligence in the three largest cohorts; FNBP1L was also significantly associated with childhood intelligence
22824798 findings suggest that Toca-1 functions at an early step in the dissemination of metastatic breast tumor cells; taken together, results identify Toca-1 as a proinvasive protein in breast adenocarcinoma
21062739 Toca-1 knockdown cells also display a significant defect in EGF-induced motility and invasiveness.
20730103 Cdc42 may influence endocytic membrane trafficking by regulating the formation and activity of the Toca-1/N-WASP complex.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19342671 FNBP1L appears dispensable for other forms of autophagy induced by serum starvation or rapamycin
19342671 Human FNBP1L binds the autophagy protein Atg3 and is required for autophagy of Salmonella Typhimurium in epithelial cells
19213734 the Toca-1-N-WASP complex can link filopodial formation to endocytosis
18191793 We show that actin tail initiation by S. flexneri requires Toca-1 for the conversion of N-WASP from a closed inactive conformation to an open active one.
More...

AA Sequence

MSWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEEPRFTSCV      1 - 70
AFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKF     71 - 140
ERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQ    141 - 210
IYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGD    211 - 280
FPFEDYSQHIYRTISDGTISASKQESGKMDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGS    281 - 350
QFLTFSIEPVHYCMNEIKTGKPRIPSFRSLKRGWSVKMGPALEDFSHLPPEQRRKKLQQRIDELNRELQK    351 - 420
ESDQKDALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGGRGDRRHSSD    421 - 490
INHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHNEFDDEFEDDDPLPAIGHCKAIYPFDGHNEGTLAMK    491 - 560
EGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEKNSKGS                             561 - 605
//

Text Mined References (33)

PMID Year Title
25547174 2014 Toca-1 is suppressed by p53 to limit breast cancer cell invasion and tumor metastasis.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358156 2014 Childhood intelligence is heritable, highly polygenic and associated with FNBP1L.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22824798 2013 Transducer of Cdc42-dependent actin assembly promotes breast cancer invasion and metastasis.
22684256 2012 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...