Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.30767717262134E-18
posterior fossa group B ependymoma 1530 4.7530422065619E-14
osteosarcoma 7933 1.31547906240525E-5
ovarian cancer 8492 1.67170355879742E-4
Breast cancer 3099 9.87071021439685E-4
nasopharyngeal carcinoma 1056 0.00102876823268743
lung carcinoma 2844 0.00195062483868877
chronic rhinosinusitis 512 0.0113124150321171
Endometriosis 535 0.0435189345142137

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma 4.100 0.000
osteosarcoma -3.503 0.000
nasopharyngeal carcinoma -2.000 0.001
Endometriosis -1.422 0.044
lung carcinoma 1.100 0.002
Breast cancer -1.400 0.001
ovarian cancer -1.600 0.000
chronic rhinosinusitis -2.352 0.011
psoriasis -1.100 0.000

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Pig OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEG      1 - 70
GITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRS     71 - 140
SAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPSLGEKDYPILF    141 - 210
KNGTLKLGGEREPVPRPKKWPIANILAPGANNIPDAFIVGGPYEEEEGELNHPEDSEFRNQAECIKKRII    211 - 280
WDLESRCYLDPSAVVSFQKRIADCRLWPVEITRVPLVTIPKGKAGKTEKTDEEAQLSFHGVAYVNMVPLL    281 - 350
YPGVKRIRGAFHVYPYLDSVVHEKTKCLLSLFRDIGHHLIHNNKIGGINSLLSKQAVSKNLKEDKPVKEK    351 - 420
DIDGRPRPGDVQAPSIKSQSSDTPLEGEPPLSHNPEGQQYVEAGTYIVLEIQLDKALVPKRMPEELARRV    421 - 490
KEMIPPRPPLTRRTGGAQKAMSDYHIQIKNISRAILDEYYRMFGKQVAKLESDMDSETLEEQKCQLSYEL    491 - 560
NCSGKYFAFKEQLKHAVVKIVRDKYLKTTSFESQEELQTFISELYVFLVDQMHVALNQTMPDDVQGTVAT    561 - 630
IYTSSEQLQLFAFEAEVNENFEMAAAYYKERLVREPQNLDHWLDYGAFCLLTEDNIKAQECFQKALSLNQ    631 - 700
SHIHSLLLCGVLAVLLENYEQAEIFFEDATCLEPTNVVAWTLLGLYYEIQNNDIRMEMAFHEASKQLQAR    701 - 770
MLQAQVTKQKSTGVEDTEERGKRESSLGPWGITNGSATAIKVEAPAGPGAALSILDKFLEESSKLQSDSQ    771 - 840
EPILTTQTWDPSISQKPSNTFIKEIPTKKEASKCQDSSALLHPGLHYGVSQTTTIFMETIHFLMKVKAVQ    841 - 910
YVHRVLAHELLCPQGGPSCEYYLVLAQTHILKKNFAKAEEYLQQAAQMDYLNPNVWGLKGHLYFLSGNHS    911 - 980
EAKACYERTISFVVDASEMHFIFLRLGLIYLEEKEYEKAKKTYMQACKRSPSCLTWLGLGIACYRLEELT    981 - 1050
EAEDALSEANALNNYNAEVWAYLALVCLKVGRQLEAEQAYKYMIKLKLKDEALLAEIHTLQETVGFGNPS   1051 - 1120
F//

Text Mined References (7)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.