Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.3e-18
nasopharyngeal carcinoma 1058 3.1e-05
ovarian cancer 8520 1.7e-04
Breast cancer 3578 9.9e-04
lung carcinoma 2843 2.0e-03
osteosarcoma 7950 4.3e-03
chronic rhinosinusitis 512 1.1e-02
ependymoma 4679 2.8e-02
Endometriosis 540 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.400 9.9e-04
chronic rhinosinusitis -2.352 1.1e-02
Endometriosis -1.422 4.4e-02
ependymoma 3.000 2.8e-02
lung carcinoma 1.100 2.0e-03
nasopharyngeal carcinoma -1.800 3.1e-05
osteosarcoma -1.333 4.3e-03
ovarian cancer -1.600 1.7e-04
psoriasis -1.100 3.3e-18

Gene RIF (1)

AA Sequence

MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEG      1 - 70
GITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRS     71 - 140
SAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPSLGEKDYPILF    141 - 210
KNGTLKLGGEREPVPRPKKWPIANILAPGANNIPDAFIVGGPYEEEEGELNHPEDSEFRNQAECIKKRII    211 - 280
WDLESRCYLDPSAVVSFQKRIADCRLWPVEITRVPLVTIPKGKAGKTEKTDEEAQLSFHGVAYVNMVPLL    281 - 350
YPGVKRIRGAFHVYPYLDSVVHEKTKCLLSLFRDIGHHLIHNNKIGGINSLLSKQAVSKNLKEDKPVKEK    351 - 420
DIDGRPRPGDVQAPSIKSQSSDTPLEGEPPLSHNPEGQQYVEAGTYIVLEIQLDKALVPKRMPEELARRV    421 - 490
KEMIPPRPPLTRRTGGAQKAMSDYHIQIKNISRAILDEYYRMFGKQVAKLESDMDSETLEEQKCQLSYEL    491 - 560
NCSGKYFAFKEQLKHAVVKIVRDKYLKTTSFESQEELQTFISELYVFLVDQMHVALNQTMPDDVQGTVAT    561 - 630
IYTSSEQLQLFAFEAEVNENFEMAAAYYKERLVREPQNLDHWLDYGAFCLLTEDNIKAQECFQKALSLNQ    631 - 700
SHIHSLLLCGVLAVLLENYEQAEIFFEDATCLEPTNVVAWTLLGLYYEIQNNDIRMEMAFHEASKQLQAR    701 - 770
MLQAQVTKQKSTGVEDTEERGKRESSLGPWGITNGSATAIKVEAPAGPGAALSILDKFLEESSKLQSDSQ    771 - 840
EPILTTQTWDPSISQKPSNTFIKEIPTKKEASKCQDSSALLHPGLHYGVSQTTTIFMETIHFLMKVKAVQ    841 - 910
YVHRVLAHELLCPQGGPSCEYYLVLAQTHILKKNFAKAEEYLQQAAQMDYLNPNVWGLKGHLYFLSGNHS    911 - 980
EAKACYERTISFVVDASEMHFIFLRLGLIYLEEKEYEKAKKTYMQACKRSPSCLTWLGLGIACYRLEELT    981 - 1050
EAEDALSEANALNNYNAEVWAYLALVCLKVGRQLEAEQAYKYMIKLKLKDEALLAEIHTLQETVGFGNPS   1051 - 1120
F//

Text Mined References (8)

PMID Year Title