Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.71
PubTator Score 5.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Sleeping sickness 37 3.427 1.7

Expression

Synonym

Accession Q5T0J7 Q5T0J8 Q5T0J9 Q8IYU6 Q8N7Z1 Q8NA15 Q9H0Q7
Symbols TSC24
C1orf49

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSAKRAELKKTHLSKNYKAVCLELKPEPTKTFDYKAVKQEGRFTKAGVTQDLKNELREVREELKEKMEEI      1 - 70
KQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRP     71 - 140
KKMDGASGVNGAPCALHKKTMAPQKTKQGSLDPLHHCGTCCEKCLLCALKNNYNRGNIPSEASGLYKGGE    141 - 210
EPVTTQPSVGHAVPAPKSQTEGR                                                   211 - 233
//

Text Mined References (11)

PMID Year Title