Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

Protein-protein Interaction (4)

AA Sequence

MIPVRGLWYCYLQVKKVRLREAERLGPKSQCPAECGAASWISWVLQHQQLLASEWATKDGRGTWGSKPSC      1 - 70
TVPALSATSQLLQLGRLNSDLQFVRQRAKKSVSSPSLLQFWCCLSRLSFHALNQKINSTNINIT           71 - 134
//

Text Mined References (6)

PMID Year Title