Property Summary

NCBI Gene PubMed Count 6
Grant Count 14
R01 Count 4
Funding $2,593,365
PubMed Score 197.82
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.000 0.003
ependymoma -1.700 0.006
oligodendroglioma -1.900 0.019
glioblastoma -1.800 0.000
osteosarcoma -1.316 0.002
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.900 0.000
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.700 0.000
ulcerative colitis -1.100 0.000

Gene RIF (1)

PMID Text
17869247 mover may act in concert with generally expressed scaffolding proteins in distinct sets of presynaptic terminals

AA Sequence

MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGS      1 - 70
IEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTEQSLLICKYDFISLQCQQVVRIALNAV     71 - 140
DTISYGEFQFPPKSLNKREGFGIRIQWDKQSRPSFINRWNPWSTNVPYATFTEHPMAGADEKTASLCQLE    141 - 210
SFKALLIQAVKKAQKESPLPGQANGVLILERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF            211 - 272
//

Text Mined References (7)

PMID Year Title
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17869247 2007 Mover is a novel vertebrate-specific presynaptic protein with differential distribution at subsets of CNS synapses.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.