Property Summary

NCBI Gene PubMed Count 6
PubMed Score 211.04
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.700 1.3e-05
astrocytic glioma -2.000 2.7e-03
Astrocytoma, Pilocytic -1.700 4.6e-12
atypical teratoid / rhabdoid tumor -2.200 6.3e-10
ependymoma -1.700 6.0e-03
glioblastoma -1.700 2.2e-09
group 3 medulloblastoma -1.800 5.9e-07
medulloblastoma, large-cell -2.700 2.1e-07
oligodendroglioma -1.900 1.9e-02
osteosarcoma -1.316 1.6e-03
primitive neuroectodermal tumor -1.900 9.9e-06
ulcerative colitis -1.100 6.5e-08

Synonym

Accession Q5T0D9 A8K1K4 Q8WV04
Symbols mover
FAM79A
h-mover

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGS      1 - 70
IEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTEQSLLICKYDFISLQCQQVVRIALNAV     71 - 140
DTISYGEFQFPPKSLNKREGFGIRIQWDKQSRPSFINRWNPWSTNVPYATFTEHPMAGADEKTASLCQLE    141 - 210
SFKALLIQAVKKAQKESPLPGQANGVLILERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF            211 - 272
//

Text Mined References (7)

PMID Year Title