Property Summary

NCBI Gene PubMed Count 2
PubMed Score 10.49
PubTator Score 0.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 5.1e-05
Disease Target Count Z-score Confidence
Chorioretinitis 6 3.29 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 5.1e-05

AA Sequence

MSRSSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLL      1 - 70
VPPAPAESSQAVMSLPKLQQVPGLHPQAVPQPDVALHARPATSTVTGLGLSTRTPSVSTSESSAGAGTGT     71 - 140
GTSTPSTPTTTSQSRLIASSPTLISGITSPPLLDSIKTIQGHGLLGPPKSERGRKKIKAENPGGPPVLVV    141 - 210
PYPILASGETAKEGKTYRCKVCPLTFFTKSEMQIHSKSHTEAKPHKCPHCSKSFANASYLAQHLRIHLGV    211 - 280
KPYHCSYCDKSFRQLSHLQQHTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAY    281 - 350
SDSASLQIHLSAHAIKHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPGIPVRISLI    351 - 420
//

Text Mined References (11)

PMID Year Title