Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.229 0.000
primary pancreatic ductal adenocarcinoma 1.002 0.020
ovarian cancer -1.500 0.000

Synonym

Accession Q5T036 A6NN20
Symbols C9orf10OS

Gene

 Compartment GO Term (2)

AA Sequence

MGKTKDIGDDDTVASEFWSGALSQPSSVPTRPRTPNRDSWRRAWAARGLHPRPSILQPGPARLSRARAGG      1 - 70
TRCPQRRHGRATFCALGRGIGVRRGPGPRPARIPGLTLTWKRMSARRMQWAMQTGGRNQTFGGGVPLFWT     71 - 140
WLTICCAVWRSLPCRLTHSCSRAFSSAPLKKTKSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTW    141 - 210
SLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSPI                            211 - 256
//

Text Mined References (4)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585507 2003 The human gene CXorf17 encodes a member of a novel family of putative transmembrane proteins: cDNA cloning and characterization of CXorf17 and its mouse ortholog orf34.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.