Property Summary

NCBI Gene PubMed Count 10
PubMed Score 47.12
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
inflammatory breast cancer -1.200 3.7e-02
intraductal papillary-mucinous neoplasm ... -1.200 1.1e-02
lung cancer -1.100 6.0e-04
medulloblastoma, large-cell -1.100 2.5e-03
osteosarcoma -1.915 1.5e-07
ovarian cancer -1.100 1.7e-06

Gene RIF (1)

AA Sequence

MAPLRFSANLSWLFPELSGLPARVRAAGSSGFEAVEVAWPYAETPEALARAAREAGLRLVLINTPPGDQE      1 - 70
KGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVL     71 - 140
AQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGH    141 - 210
VQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRGHPEAGQ       211 - 277
//

Text Mined References (13)

PMID Year Title