Property Summary

NCBI Gene PubMed Count 10
PubMed Score 47.12
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
inflammatory breast cancer -1.200 3.7e-02
intraductal papillary-mucinous neoplasm ... -1.200 1.1e-02
lung cancer -1.100 6.0e-04
medulloblastoma, large-cell -1.100 2.5e-03
osteosarcoma -1.915 1.5e-07
ovarian cancer -1.100 1.7e-06

Synonym

Accession Q5T013 D3DPX4 D3DPX5 Q5Q9A2 Q7Z778 Q96S83 Q9BZR3 Q9BZR4
Symbols HT036

Gene

HYI

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAPLRFSANLSWLFPELSGLPARVRAAGSSGFEAVEVAWPYAETPEALARAAREAGLRLVLINTPPGDQE      1 - 70
KGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVL     71 - 140
AQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGH    141 - 210
VQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRGHPEAGQ       211 - 277
//

Text Mined References (13)

PMID Year Title