Property Summary

NCBI Gene PubMed Count 10
Grant Count 15
R01 Count 7
Funding $1,486,678.81
PubMed Score 73.44
PubTator Score 24.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 0.040
glioblastoma -3.000 0.000
posterior fossa group A ependymoma -3.000 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -1.200 0.007
adult high grade glioma -2.700 0.000
pilocytic astrocytoma -2.600 0.000
lung carcinoma 2.400 0.000
psoriasis -1.900 0.000

Gene RIF (3)

PMID Text
25145264 Gomafu indirectly modulates the function of the splicing factors SF1 and Celf3 by sequestering these proteins into separate nuclear bodies.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE      1 - 70
QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV     71 - 140
KFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSAYTQA    141 - 210
LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVN    211 - 280
GYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALV    281 - 350
AQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQS    351 - 420
KCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY                             421 - 465
//

Text Mined References (12)

PMID Year Title
25145264 2014 Formation of nuclear bodies by the lncRNA Gomafu-associating proteins Celf3 and SF1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17725984 2007 Expression, localization and tau exon 10 splicing activity of the brain RNA-binding protein TNRC4.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009664 2004 Tau exon 10, whose missplicing causes frontotemporal dementia, is regulated by an intricate interplay of cis elements and trans factors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11158314 2001 The CELF family of RNA binding proteins is implicated in cell-specific and developmentally regulated alternative splicing.
More...