Property Summary

NCBI Gene PubMed Count 10
PubMed Score 74.80
PubTator Score 24.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.700 1.9e-05
astrocytic glioma -1.200 4.0e-02
Astrocytoma, Pilocytic -2.600 1.4e-08
atypical teratoid / rhabdoid tumor -3.200 5.7e-06
ependymoma -2.800 2.5e-11
glioblastoma -1.900 1.3e-05
lung carcinoma 2.400 5.2e-47
medulloblastoma, large-cell -1.200 7.1e-03
psoriasis -1.900 2.6e-05

Gene RIF (3)

AA Sequence

MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE      1 - 70
QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV     71 - 140
KFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSAYTQA    141 - 210
LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVN    211 - 280
GYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALV    281 - 350
AQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQS    351 - 420
KCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY                             421 - 465
//

Text Mined References (12)

PMID Year Title