Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.27
PubTator Score 2.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
21938754 Detection of a novel imatinib-sensitive C6orf204-PDGFRB fusion in a patient with precursor T lymphoblastic lymphoma (T-ALL) and an associated myeloproliferative neoplasm with eosinophilia.
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MWGRFLAPEASGRDSPGGARSFPAGPDYSSAWLPANESLWQATTVPSNHRNNHIRRHSIASDSGDTGIGT      1 - 70
SCSDSVEDHSTSSGTLSFKPSQSLITLPTAHVMPSNSSASISKLRESLTPDGSKWSTSLMQTLGNHSRGE     71 - 140
QDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEKIGKAKALTSQLRTIGPSCLHDSMEM    141 - 210
LRLEDKEINKKRSSTLDCKYKFESCSKEDFRASSSTLRRQPVDMTYSALPESKPIMTSSEAFEPPKYLML    211 - 280
GQQAVGGVPIQPSVRTQMWLTEQLRTNPLEGRNTEDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSY    281 - 350
SPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQP    351 - 420
QYENTSLQTPFSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEEKLKTRDRYISSL    421 - 490
KKKCQKESEQNKEKQRRIETLEKYLADLPTLDDVQSQSLQLQILEEKNKNLQEALIDTEKKLEEIKKQCQ    491 - 560
DKETQLICQKKKEKELVTTVQSLQQKVERCLEDGIRLPMLDAKQLQNENDNLRQQNETASKIIDSQQDEI    561 - 630
DRMILEIQSMQGKLSKEKLTTQKMMEELEKKERNVQRLTKALLENQRQTDETCSLLDQGQEPDQSRQQTV    631 - 700
LSKRPLFDLTVIDQLFKEMSCCLFDLKALCSILNQRAQGKEPNLSLLLGIRSMNCSAEETENDHSTETLT    701 - 770
KKLSDVCQLRRDIDELRTTISDRYAQDMGDNCITQ                                       771 - 805
//

Text Mined References (18)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
23463857 2013 Genome- and phenome-wide analyses of cardiac conduction identifies markers of arrhythmia risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22010048 2012 A genome-wide association study identifies a novel susceptibility locus for renal cell carcinoma on 12p11.23.
21938754 2012 Systematic screen for tyrosine kinase rearrangements identifies a novel C6orf204-PDGFRB fusion in a patient with recurrent T-ALL and an associated myeloproliferative neoplasm.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
More...