Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.54
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.200 7.5e-05
astrocytic glioma -1.800 2.1e-02
Astrocytoma, Pilocytic -1.600 1.5e-06
atypical teratoid / rhabdoid tumor -5.200 1.6e-10
ependymoma -2.400 2.3e-02
glioblastoma -2.400 9.0e-07
group 3 medulloblastoma -2.800 5.2e-04
lung carcinoma 1.300 3.0e-29
medulloblastoma, large-cell -4.300 8.7e-07
oligodendroglioma -1.200 2.9e-08
ovarian cancer 1.700 2.0e-03
Pick disease -1.700 5.1e-03
pituitary cancer 1.500 6.5e-03
primitive neuroectodermal tumor -3.300 4.9e-04

AA Sequence

MQKIVQTDEITNTQAFRKGKRKRTETMDSENANSDMDKGQRDPYSGNAFLPGESSSEDEEPLAELSKEEL      1 - 70
CAKIKSLKEKLTNTRKENSRLRQSLVMLQVLPQAVTQFEELVGMAEALLKGGGTMSTSASTLWRATNNSS     71 - 140
PDSFASTCSNSNSNSSSPVSLKPEEEHQTDEKQFQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHS    141 - 210
LTGAKSSTSRDKAVKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTKKPNLSKNLNSQDIK     211 - 279
//

Text Mined References (6)

PMID Year Title