Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.54
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.800 0.021
ependymoma -3.500 0.000
glioblastoma -3.500 0.000
oligodendroglioma -1.200 0.000
medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -5.200 0.000
medulloblastoma, large-cell -4.300 0.000
primitive neuroectodermal tumor -3.300 0.000
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -1.600 0.000
lung carcinoma 1.300 0.000
Pick disease -1.700 0.005
ovarian cancer 1.700 0.002
pituitary cancer 1.500 0.006

AA Sequence

MQKIVQTDEITNTQAFRKGKRKRTETMDSENANSDMDKGQRDPYSGNAFLPGESSSEDEEPLAELSKEEL      1 - 70
CAKIKSLKEKLTNTRKENSRLRQSLVMLQVLPQAVTQFEELVGMAEALLKGGGTMSTSASTLWRATNNSS     71 - 140
PDSFASTCSNSNSNSSSPVSLKPEEEHQTDEKQFQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHS    141 - 210
LTGAKSSTSRDKAVKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTKKPNLSKNLNSQDIK     211 - 279
//

Text Mined References (6)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23571214 2013 BEND6 is a nuclear antagonist of Notch signaling during self-renewal of neural stem cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.