Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.38
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5SZB4 Q2M1I2 Q8NA65
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MFWRRLRPGAQDLAPKGLPGDGDFRRSSDPRLPKLTPPALRAALGARGSGDWRIPGGGAAWWPEGDAKPG      1 - 70
VGVGRLPPRLPALLTATRRAVRKRGLLRSLLPPPLLSAGASRESAPRQPGPGERERPRRRVAREDPDFLG     71 - 140
AFLGELLPSRFREFLHQLQEKCAEEPEPLTSPAPQHQRGVLEHCPGSPRCPNCSFLPDLWGQSSHLQDSL    141 - 210
TKISLQQTPILGPLKGDHSQFTTVRKANHRPHGAQVPRLKAALTHNPSGEGSRPCRQRCPFRVRFADETL    211 - 280
QDTTLRYWERRRSVQQSVIVNQKAALPVASERVFGSVGKRLESLPKALYPGAKEETLASSSCWDCAGLST    281 - 350
QKTQGYLSEDTSMNSSLPFCSWKKAAAQRPRSSLRAFLDPHRNLEQESLLPNRVLQSVLKQGCPKGYHLL    351 - 420
LASATLQPDKR                                                               421 - 431
//

Text Mined References (8)

PMID Year Title
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21382349 2011 Identification of the human testis protein phosphatase 1 interactome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.