Property Summary

NCBI Gene PubMed Count 3
PubMed Score 5.37
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.9173632543187E-15
astrocytoma 1493 4.17989680920547E-15
non-small cell lung cancer 2798 2.02528264145441E-10
ovarian cancer 8492 1.15080481841E-9
lung adenocarcinoma 2714 2.66681492977301E-7
pituitary cancer 1972 2.8105147844807E-6
oligodendroglioma 2849 2.90952526352678E-6
sonic hedgehog group medulloblastoma 1482 3.76687299176827E-6
ependymoma 2514 6.72174335106738E-6
cystic fibrosis 1670 7.50722125812628E-5
ulcerative colitis 2087 1.88538083008263E-4
pilocytic astrocytoma 3086 2.16104540588874E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.80932547551629E-4
glioblastoma 5572 0.0014131998732516
pediatric high grade glioma 2712 0.00266798158039423
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00562035717949886
osteosarcoma 7933 0.0103599266314534
atypical teratoid/rhabdoid tumor 1095 0.0286031736897236
spina bifida 1064 0.0336614838031966

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.300 0.000
glioblastoma 1.200 0.001
oligodendroglioma 1.100 0.000
osteosarcoma -1.474 0.010
ependymoma 1.500 0.000
sonic hedgehog group medulloblastoma 1.900 0.000
cystic fibrosis 2.146 0.000
non-small cell lung cancer -1.298 0.000
intraductal papillary-mucinous adenoma (... 2.200 0.001
intraductal papillary-mucinous carcinoma... 2.100 0.006
lung adenocarcinoma -1.200 0.000
pediatric high grade glioma 1.200 0.003
atypical teratoid/rhabdoid tumor 1.100 0.029
pilocytic astrocytoma 1.400 0.000
lung carcinoma -1.900 0.000
spina bifida -2.052 0.034
ulcerative colitis -1.600 0.000
ovarian cancer -3.400 0.000
pituitary cancer -1.500 0.000

Synonym

Accession Q5SYE7 Q3ZCS5 Q5SYE8 Q9P2J0
Symbols C6orf63

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MKKEGSSGSFRLQPNTGSLSRAVSWINFSSLSRQTKRLFRSDGELSVCGQQVEVDDENWIYRAQPRKAVS      1 - 70
NLDEESRWTVHYTAPWHQQENVFLPTTRPPCVEDLHRQAKLNLKSVLRECDKLRHDGYRSSQYYSQGPTF     71 - 140
AANASPFCDDYQDEDEETDQKCSLSSSEEERFISIRRPKTPASSDFSDLNTQTNWTKSLPLPTPEEKMRQ    141 - 210
QAQTVQADVVPINITASGTGQDDADGHSVYTPDHYSTLGRFNSCRSAGQRSETRDSSCQTEDVKVVPPSM    211 - 280
RRIRAQKGQGIAAQMGHFSGSSGNMSVLSDSAGIVFPSRLDSDAGFHSLPRSGARANIQSLEPRLGALGP    281 - 350
AGDMNGTFLYQRGHPQADENLGHLGGASGTGTLLRPKSQELRHFESENIMSPACVVSPHATYSTSIIPNA    351 - 420
TLSSSSEVIAIPTAQSAGQRESKSSGSSHARIKSRDHLISRHAVKGDPQSPGRHWNEGHATILSQDLDPH    421 - 490
SPGEPALLSLCDSAVPLNAPANRENGSQAMPYNCRNNLAFPAHPQDVDGKSESSYSGGGGHSSSEPWEYK    491 - 560
SSGNGRASPLKPHLATPGYSTPTSNMSSCSLDQTSNKEDAGSLYSEDHDGYCASVHTDSGHGSGNLCNSS    561 - 630
DGFGNPRHSVINVFVGRAQKNQGDRSNYQDKSLSRNISLKKAKKPPLPPSRTDSLRRIPKKSSQCNGQVL    631 - 700
NESLIATLQHSLQLSLPGKSGSSPSQSPCSDLEEPWLPRSRSQSTVSAGSSMTSATTPNVYSLCGATPSQ    701 - 770
SDTSSVKSEYTDPWGYYIDYTGMQEDPGNPAGGCSTSSGVPTGNGPVRHVQEGSRATMPQVPGGSVKPKI    771 - 840
MSPEKSHRVISPSSGYSSQSNTPTALTPVPVFLKSVSPANGKGKPKPKVPERKSSLISSVSISSSSTSLS    841 - 910
SSTSTEGSGTMKKLDPAVGSPPAPPPPPVPSPPFPCPADRSPFLPPPPPVTDCSQGSPLPHSPVFPPPPP    911 - 980
EALIPFCSPPDWCLSPPRPALSPILPDSPVSLPLPPPLLPSSEPPPAPPLDPKFMKDTRPPFTNSGQPES    981 - 1050
SRGSLRPPSTKEETSRPPMPLITTEALQMVQLRPVRKNSGAEAAQLSERTAQEQRTPVAPQYHLKPSAFL   1051 - 1120
KSRNSTNEMESESQPASVTSSLPTPAKSSSQGDHGSAAERGGPVSRSPGAPSAGEAEARPSPSTTPLPDS   1121 - 1190
SPSRKPPPISKKPKLFLVVPPPQKDFAVEPAENVSEALRAVPSPTTGEEGSVHSREAKESSAAQAGSHAT   1191 - 1260
HPGTSVLEGGAAGSMSPSRVEANVPMVQPDVSPAPKQEEPAENSADTGGDGESCLSQQDGAAGVPETNAA   1261 - 1330
GSSSEACDFLKEDGNDEVMTPSRPRTTEDLFAAIHRSKRKVLGRRDSDDDHSRNHSPSPPVTPTGAAPSL   1331 - 1400
ASPKQVGSIQRSIRKSSTSSDNFKALLLKKGSRSDTSARMSAAEMLKNTDPRFQRSRSEPSPDAPESPSS   1401 - 1470
CSPSKNRRAQEEWAKNEGLMPRSLSFSGPRYGRSRTPPSAASSRYSMRNRIQSSPMTVISEGEGEAVEPV   1471 - 1540
DSIARGALGAAEGCSLDGLAREEMDEGGLLCGEGPAASLQPQAPGPVDGTASAEGREPSPQCGGSLSEES   1541 - 1610
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466011 2004 Identification of the gene for Nance-Horan syndrome (NHS).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...