Property Summary

NCBI Gene PubMed Count 3
PubMed Score 5.57
PubTator Score 1.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.300 4.2e-15
Astrocytoma, Pilocytic 1.400 2.3e-04
atypical teratoid/rhabdoid tumor 1.100 2.9e-02
cystic fibrosis 2.146 7.5e-05
ependymoma 1.500 6.7e-06
glioblastoma 1.200 1.4e-03
intraductal papillary-mucinous adenoma (... 2.200 6.8e-04
intraductal papillary-mucinous carcinoma... 2.100 5.6e-03
lung adenocarcinoma -1.100 8.6e-10
lung carcinoma -1.900 1.9e-15
medulloblastoma 1.400 1.2e-03
non-small cell lung cancer -1.298 2.0e-10
oligodendroglioma 1.100 2.9e-06
osteosarcoma -1.474 1.0e-02
ovarian cancer -3.400 1.2e-09
pediatric high grade glioma 1.200 2.7e-03
pituitary cancer -1.500 2.8e-06
spina bifida -2.052 3.4e-02
ulcerative colitis -1.600 1.9e-04

Synonym

Accession Q5SYE7 Q3ZCS5 Q5SYE8 Q9P2J0
Symbols C6orf63

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MKKEGSSGSFRLQPNTGSLSRAVSWINFSSLSRQTKRLFRSDGELSVCGQQVEVDDENWIYRAQPRKAVS      1 - 70
NLDEESRWTVHYTAPWHQQENVFLPTTRPPCVEDLHRQAKLNLKSVLRECDKLRHDGYRSSQYYSQGPTF     71 - 140
AANASPFCDDYQDEDEETDQKCSLSSSEEERFISIRRPKTPASSDFSDLNTQTNWTKSLPLPTPEEKMRQ    141 - 210
QAQTVQADVVPINITASGTGQDDADGHSVYTPDHYSTLGRFNSCRSAGQRSETRDSSCQTEDVKVVPPSM    211 - 280
RRIRAQKGQGIAAQMGHFSGSSGNMSVLSDSAGIVFPSRLDSDAGFHSLPRSGARANIQSLEPRLGALGP    281 - 350
AGDMNGTFLYQRGHPQADENLGHLGGASGTGTLLRPKSQELRHFESENIMSPACVVSPHATYSTSIIPNA    351 - 420
TLSSSSEVIAIPTAQSAGQRESKSSGSSHARIKSRDHLISRHAVKGDPQSPGRHWNEGHATILSQDLDPH    421 - 490
SPGEPALLSLCDSAVPLNAPANRENGSQAMPYNCRNNLAFPAHPQDVDGKSESSYSGGGGHSSSEPWEYK    491 - 560
SSGNGRASPLKPHLATPGYSTPTSNMSSCSLDQTSNKEDAGSLYSEDHDGYCASVHTDSGHGSGNLCNSS    561 - 630
DGFGNPRHSVINVFVGRAQKNQGDRSNYQDKSLSRNISLKKAKKPPLPPSRTDSLRRIPKKSSQCNGQVL    631 - 700
NESLIATLQHSLQLSLPGKSGSSPSQSPCSDLEEPWLPRSRSQSTVSAGSSMTSATTPNVYSLCGATPSQ    701 - 770
SDTSSVKSEYTDPWGYYIDYTGMQEDPGNPAGGCSTSSGVPTGNGPVRHVQEGSRATMPQVPGGSVKPKI    771 - 840
MSPEKSHRVISPSSGYSSQSNTPTALTPVPVFLKSVSPANGKGKPKPKVPERKSSLISSVSISSSSTSLS    841 - 910
SSTSTEGSGTMKKLDPAVGSPPAPPPPPVPSPPFPCPADRSPFLPPPPPVTDCSQGSPLPHSPVFPPPPP    911 - 980
EALIPFCSPPDWCLSPPRPALSPILPDSPVSLPLPPPLLPSSEPPPAPPLDPKFMKDTRPPFTNSGQPES    981 - 1050
SRGSLRPPSTKEETSRPPMPLITTEALQMVQLRPVRKNSGAEAAQLSERTAQEQRTPVAPQYHLKPSAFL   1051 - 1120
KSRNSTNEMESESQPASVTSSLPTPAKSSSQGDHGSAAERGGPVSRSPGAPSAGEAEARPSPSTTPLPDS   1121 - 1190
SPSRKPPPISKKPKLFLVVPPPQKDFAVEPAENVSEALRAVPSPTTGEEGSVHSREAKESSAAQAGSHAT   1191 - 1260
HPGTSVLEGGAAGSMSPSRVEANVPMVQPDVSPAPKQEEPAENSADTGGDGESCLSQQDGAAGVPETNAA   1261 - 1330
GSSSEACDFLKEDGNDEVMTPSRPRTTEDLFAAIHRSKRKVLGRRDSDDDHSRNHSPSPPVTPTGAAPSL   1331 - 1400
ASPKQVGSIQRSIRKSSTSSDNFKALLLKKGSRSDTSARMSAAEMLKNTDPRFQRSRSEPSPDAPESPSS   1401 - 1470
CSPSKNRRAQEEWAKNEGLMPRSLSFSGPRYGRSRTPPSAASSRYSMRNRIQSSPMTVISEGEGEAVEPV   1471 - 1540
DSIARGALGAAEGCSLDGLAREEMDEGGLLCGEGPAASLQPQAPGPVDGTASAEGREPSPQCGGSLSEES   1541 - 1610
//

Text Mined References (14)

PMID Year Title